(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE149

PENCW_16.PE149       Location/Qualifiers
FT   CDS             join(330355..330986,331053..331428)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671675"
FT                   /orf_name="Pc20g01490"
FT                   /product="Pc20g01490 protein"
FT                   /protein_id="CAP85478.1"
FT                   /db_xref="UniParc:UPI00018311F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF6"
FT                   /transl_table=1
FT                   /translation="MDDLPPGSRLAHVRSELAMDSESEESESATPTNADTAKTETEPFP
FT                   EYDESECEMLASSIAADKRREEAWIHALGKATQRENRMLHVDPNIIPYFQSDPSHRSQV
FT                   VLEQLRDLLADPQMRPKIRDQFITMINATLQFNLVIFHQSSEFLAPKEIEDAELHLESV
FT                   LNLVEWMEEDLRDQLETAEQVSYAIEGASLQPTSAYERLCKMASLFANAMKKPRYLERR
FT                   LLSLYMDMYEEWVHTPFLLLRNRQLVNEQDPSPERTKLSRRVIMIWDLMNSCIESYGTL
FT                   TWFTLEIKHQYFAPVMGYLCDSPEIWQYCWDQYQALEKDRAQASEKDLSQCATI"
     MDDLPPGSRL AHVRSELAMD SESEESESAT PTNADTAKTE TEPFPEYDES ECEMLASSIA        60
     ADKRREEAWI HALGKATQRE NRMLHVDPNI IPYFQSDPSH RSQVVLEQLR DLLADPQMRP       120
     KIRDQFITMI NATLQFNLVI FHQSSEFLAP KEIEDAELHL ESVLNLVEWM EEDLRDQLET       180
     AEQVSYAIEG ASLQPTSAYE RLCKMASLFA NAMKKPRYLE RRLLSLYMDM YEEWVHTPFL       240
     LLRNRQLVNE QDPSPERTKL SRRVIMIWDL MNSCIESYGT LTWFTLEIKH QYFAPVMGYL       300
     CDSPEIWQYC WDQYQALEKD RAQASEKDLS QCATI                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page