(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE15

PENCW_16.PE15        Location/Qualifiers
FT   CDS             join(42568..42585,42688..45747)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000187708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946676"
FT                   /orf_name="Pc20g00150"
FT                   /product="Pc20g00150 protein"
FT                   /protein_id="CAP85344.1"
FT                   /db_xref="UniParc:UPI0001831907"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF26"
FT                   /transl_table=1
FT                   /translation="MDHISTLCALSTVGIAPTGLALGRAERTQRPSLFRRKTHAQGIPE
FT                   PLSVNTEPTADVARPKTAIPSRSPAAEWLAAKEEESFQGSQGSDLSKAPLSFSGARRRR
FT                   RGQTLTNPPLRIPEHESTDSSVGTHTRRPSTGWLRRLSMASFPAETPTASSPATPSFNG
FT                   STSPLISHSPRQRRPANKLVKRPTSQHTTTYALTLNPICGPSPAALRRPATSHQRSESM
FT                   ILRTPLTTDFDTYFPKAPVEGPTIEEFELDKQKRWTPFFVPKGGKLAERLSRRFSTSTA
FT                   PKVQSVRQIVSDQGALPALVMANVISPTTAAPRDDRSVPHTPIEFHNPFQTAPSEFGPK
FT                   QPVAPEQPAERSLHRQSYSVNDVEPKIEPKIVMANTVTAHGTPIMGLVRGGSLKRVKGR
FT                   TFSVPPSELSQEENNVAIPSSPEPEPRRNITDPSVFRAPYPISQPGWADSALERRSQVG
FT                   PRSVSQDYNVGLGSRAGSRQMTSDAVALSAWQQASRPGGQTYGSLRRRPKGFSISGSDP
FT                   ASTLIGSDATRVFTSSDGYETDMMSDYWDSVRTRETNRSGAKGLRIETMFDKAGTSLAN
FT                   EEATTLESLLPRGSFAARSLDKDPQLFTDPLLSAPPLVQTSMGENPSIPDDDALSMIGA
FT                   LPSDDRDCFPSSLTRSLAKYAEEPELRVGADNDMPGSFMGELDSDINKKTNIFDWSEQT
FT                   HPNRETSDSGTRPRTMQGKHEGVIDRNSRAVCRKAPSTVHLRSQSVPVASELPINESRQ
FT                   TSGKFGTWGLGSKGVSEDWDSDFDFDESEDTPVAENKPLVEPDINRQSMTVPKAILERQ
FT                   ASLRGQFGQVQELTLLVEELKRLRHQANVLGVVNGPSSELWAEAEQIVNLATIDDEEER
FT                   RSPPGSPQSLTFSFDESDDDGLNASSKRNSDVLWDIPRGENSEPTLPLAQLARDSPKSK
FT                   SVLDILQPRQQEPSSAFNGLELASRAKKLPFDTSSLKNLVVRAGVVTRALKEVIRKADG
FT                   VATSPQDFQDPPFRRIFDKPSHDDIASFEAALADMS"
     MDHISTLCAL STVGIAPTGL ALGRAERTQR PSLFRRKTHA QGIPEPLSVN TEPTADVARP        60
     KTAIPSRSPA AEWLAAKEEE SFQGSQGSDL SKAPLSFSGA RRRRRGQTLT NPPLRIPEHE       120
     STDSSVGTHT RRPSTGWLRR LSMASFPAET PTASSPATPS FNGSTSPLIS HSPRQRRPAN       180
     KLVKRPTSQH TTTYALTLNP ICGPSPAALR RPATSHQRSE SMILRTPLTT DFDTYFPKAP       240
     VEGPTIEEFE LDKQKRWTPF FVPKGGKLAE RLSRRFSTST APKVQSVRQI VSDQGALPAL       300
     VMANVISPTT AAPRDDRSVP HTPIEFHNPF QTAPSEFGPK QPVAPEQPAE RSLHRQSYSV       360
     NDVEPKIEPK IVMANTVTAH GTPIMGLVRG GSLKRVKGRT FSVPPSELSQ EENNVAIPSS       420
     PEPEPRRNIT DPSVFRAPYP ISQPGWADSA LERRSQVGPR SVSQDYNVGL GSRAGSRQMT       480
     SDAVALSAWQ QASRPGGQTY GSLRRRPKGF SISGSDPAST LIGSDATRVF TSSDGYETDM       540
     MSDYWDSVRT RETNRSGAKG LRIETMFDKA GTSLANEEAT TLESLLPRGS FAARSLDKDP       600
     QLFTDPLLSA PPLVQTSMGE NPSIPDDDAL SMIGALPSDD RDCFPSSLTR SLAKYAEEPE       660
     LRVGADNDMP GSFMGELDSD INKKTNIFDW SEQTHPNRET SDSGTRPRTM QGKHEGVIDR       720
     NSRAVCRKAP STVHLRSQSV PVASELPINE SRQTSGKFGT WGLGSKGVSE DWDSDFDFDE       780
     SEDTPVAENK PLVEPDINRQ SMTVPKAILE RQASLRGQFG QVQELTLLVE ELKRLRHQAN       840
     VLGVVNGPSS ELWAEAEQIV NLATIDDEEE RRSPPGSPQS LTFSFDESDD DGLNASSKRN       900
     SDVLWDIPRG ENSEPTLPLA QLARDSPKSK SVLDILQPRQ QEPSSAFNGL ELASRAKKLP       960
     FDTSSLKNLV VRAGVVTRAL KEVIRKADGV ATSPQDFQDP PFRRIFDKPS HDDIASFEAA      1020
     LADMS                                                                  1025
//

If you have problems or comments...

PBIL Back to PBIL home page