(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE150

PENCW_16.PE150       Location/Qualifiers
FT   CDS             join(complement(332390..332691),complement(331607..332321))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000254104" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947754"
FT                   /orf_name="Pc20g01500"
FT                   /product="Pc20g01500 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85479.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI00018311F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF7"
FT                   /transl_table=1
FT                   /translation="MLGKIALEEAFALPRFREKTKWWAGMFATDTEKHTAEINDVGPIR
FT                   LDFAERHGVGLQILSYTAPGVQDIWDAKDAQALAVEINDYIAEKVKAHPDRFAAFATLS
FT                   MHDPQEAAAELRRCVTQHGFLGALVNDTQRAGADGDDMIFYDNEKWDVFWATCTELDVP
FT                   LYLHPRNPTGTIYDKLWADRKWLIGPPLSFAQGVSLHVLGMVTNGVFDRNPKLQVILGH
FT                   LGEHIPFDMWRINHWFEDRKKMLGLGETCKRTIREYFAENLWITTSGHFSTTTLNFCMA
FT                   EVGADRILFSIDYPFETFADACDWFDSAEMSNTDRLKIGRENAKKLFKLGAYKDSTA"
     MLGKIALEEA FALPRFREKT KWWAGMFATD TEKHTAEIND VGPIRLDFAE RHGVGLQILS        60
     YTAPGVQDIW DAKDAQALAV EINDYIAEKV KAHPDRFAAF ATLSMHDPQE AAAELRRCVT       120
     QHGFLGALVN DTQRAGADGD DMIFYDNEKW DVFWATCTEL DVPLYLHPRN PTGTIYDKLW       180
     ADRKWLIGPP LSFAQGVSLH VLGMVTNGVF DRNPKLQVIL GHLGEHIPFD MWRINHWFED       240
     RKKMLGLGET CKRTIREYFA ENLWITTSGH FSTTTLNFCM AEVGADRILF SIDYPFETFA       300
     DACDWFDSAE MSNTDRLKIG RENAKKLFKL GAYKDSTA                               338
//

If you have problems or comments...

PBIL Back to PBIL home page