(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE151

PENCW_16.PE151       Location/Qualifiers
FT   CDS             join(complement(333212..333559),complement(332980..333138))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234778" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947755"
FT                   /orf_name="Pc20g01510"
FT                   /product="Pc20g01510 protein"
FT                   /protein_id="CAP85480.1"
FT                   /db_xref="UniParc:UPI00018311F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF8"
FT                   /transl_table=1
FT                   /translation="MATRTIYLISARNTSFQRAHFSIFVPSATNPDRGTKIHAVGAPMA
FT                   GYVLEFKRNYNPSLEPHDQTFPIGQVHSSDVVDSPDAAPSIDSTPRGKIELAATQVPTP
FT                   GINQNFMAPVNDTTNKRCQEWTMEYVRHLVAKGLVDKEAIEIVQSKRDPPTHGIGLRSV
FT                   TRPGT"
     MATRTIYLIS ARNTSFQRAH FSIFVPSATN PDRGTKIHAV GAPMAGYVLE FKRNYNPSLE        60
     PHDQTFPIGQ VHSSDVVDSP DAAPSIDSTP RGKIELAATQ VPTPGINQNF MAPVNDTTNK       120
     RCQEWTMEYV RHLVAKGLVD KEAIEIVQSK RDPPTHGIGL RSVTRPGT                    168
//

If you have problems or comments...

PBIL Back to PBIL home page