(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE153

PENCW_16.PE153       Location/Qualifiers
FT   CDS             join(complement(338923..339298),complement(338114..338868),
FT                   complement(338003..338053),complement(337282..337944))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000158970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947756"
FT                   /orf_name="Pc20g01530"
FT                   /product="Pc20g01530 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85482.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018311F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG0"
FT                   /transl_table=1
FT                   /translation="MTKREKIDTLSEKVVPQQPFGTAERARRDLNAKLSNPLAGFSHTE
FT                   LRDQGRTFAELHEMGDESDIRAFELGAVLAQSPERYDNVAGLTNKEKAVLRREVTHRWS
FT                   QPWKMYVVITLCSLSATVQGMDQTVVNGAQIFYKHQFGIGDGSSRSAWLVGLVNSAPYL
FT                   CCAFISSWLTVPFNHWFGRRGTIFIACCLSAITCLWQGFVSTWWAMFVARFMLGFGIGP
FT                   KSATVPIYAAETAPPSIRGALVMQWHVWTAFGIMVGYASDLIFYNVESSAIVGLNWRCM
FT                   MASAMFPALVVCCFVFACPESPHWYIRQKQYYRAYRSICTLRNHKIQAARDLYYMHTLL
FT                   EAENSIKLGRNKLLELIKVPRNRRAMLASQIVMFMQQFCGVNVISYYSSEIFLEANFSP
FT                   PAALAASLGWGLINWLLSIPAIYTIDTFGRRNLLLLTFPLMSMAMLFTGFSFWIPESSH
FT                   HARLACIALGTYLFGVVYSPGEGPVPFTYTAEVYPLYVRSYGMALGTATMWFCNFLLGV
FT                   TWPSLRAAFTTQGAFAWHASWCFVGWWMILLFMPETKGKTLEELDQVFSVPTRLHARYG
FT                   LRQIGYFFKRYLLRRDIRPEALYEREELVKAQDVGFNA"
     MTKREKIDTL SEKVVPQQPF GTAERARRDL NAKLSNPLAG FSHTELRDQG RTFAELHEMG        60
     DESDIRAFEL GAVLAQSPER YDNVAGLTNK EKAVLRREVT HRWSQPWKMY VVITLCSLSA       120
     TVQGMDQTVV NGAQIFYKHQ FGIGDGSSRS AWLVGLVNSA PYLCCAFISS WLTVPFNHWF       180
     GRRGTIFIAC CLSAITCLWQ GFVSTWWAMF VARFMLGFGI GPKSATVPIY AAETAPPSIR       240
     GALVMQWHVW TAFGIMVGYA SDLIFYNVES SAIVGLNWRC MMASAMFPAL VVCCFVFACP       300
     ESPHWYIRQK QYYRAYRSIC TLRNHKIQAA RDLYYMHTLL EAENSIKLGR NKLLELIKVP       360
     RNRRAMLASQ IVMFMQQFCG VNVISYYSSE IFLEANFSPP AALAASLGWG LINWLLSIPA       420
     IYTIDTFGRR NLLLLTFPLM SMAMLFTGFS FWIPESSHHA RLACIALGTY LFGVVYSPGE       480
     GPVPFTYTAE VYPLYVRSYG MALGTATMWF CNFLLGVTWP SLRAAFTTQG AFAWHASWCF       540
     VGWWMILLFM PETKGKTLEE LDQVFSVPTR LHARYGLRQI GYFFKRYLLR RDIRPEALYE       600
     REELVKAQDV GFNA                                                         614
//

If you have problems or comments...

PBIL Back to PBIL home page