(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE154

PENCW_16.PE154       Location/Qualifiers
FT   CDS             join(340636..340675,340738..341011,341080..341427,
FT                   341485..341674)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181113" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947757"
FT                   /orf_name="Pc20g01540"
FT                   /product="Pc20g01540 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP85483.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00018311F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG1"
FT                   /transl_table=1
FT                   /translation="MDDAESPRLEEQQTPTKSPFTNVRTDGRAFNSPNWRMKAESPATP
FT                   SRTNASPSANPNTSRAAFSRPGAHVPQAINDGRRLYVGNMPYTAKMEDVEALFIAAEFP
FT                   IERIDIAIDPFTGRNPSYCFVDLQNKEHAERAMTELDGRDMLGRPVKIKPGVAKSQERI
FT                   QNPPEPFRIDCWRQQERPSFAKVNSDSSSRVYVGGLPRLTDHGAVQTNIEMFFKGFKVE
FT                   HVSKLFTPHPAKRFEPGEHYYLFVDVGSPEQALKAMDTLNGREGPWGGPLRVQFARGTK
FT                   DT"
     MDDAESPRLE EQQTPTKSPF TNVRTDGRAF NSPNWRMKAE SPATPSRTNA SPSANPNTSR        60
     AAFSRPGAHV PQAINDGRRL YVGNMPYTAK MEDVEALFIA AEFPIERIDI AIDPFTGRNP       120
     SYCFVDLQNK EHAERAMTEL DGRDMLGRPV KIKPGVAKSQ ERIQNPPEPF RIDCWRQQER       180
     PSFAKVNSDS SSRVYVGGLP RLTDHGAVQT NIEMFFKGFK VEHVSKLFTP HPAKRFEPGE       240
     HYYLFVDVGS PEQALKAMDT LNGREGPWGG PLRVQFARGT KDT                         283
//

If you have problems or comments...

PBIL Back to PBIL home page