(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE155

PENCW_16.PE155       Location/Qualifiers
FT   CDS             join(343174..343273,343325..343911,343967..344632)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181112" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824359"
FT                   /orf_name="Pc20g01550"
FT                   /product="Pc20g01550 protein"
FT                   /function="6-phosphofructo-2-kinase activity"
FT                   /function="ATP binding"
FT                   /biological_process="fructose 2,6-bisphosphate metabolic
FT                   process"
FT                   /protein_id="CAP85484.1"
FT                   /db_xref="GO:0003873"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006003"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR016260"
FT                   /db_xref="UniParc:UPI00018312CF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG2"
FT                   /transl_table=1
FT                   /translation="MPIANFGTQSDDSKICVVMVGLPARGKSLIAGKAMRYLGWVGIPA
FT                   RVFNVGSYRRFSTPQPQAGFFDPHNEEGERMRRAAAEAAMSDMLQWFNTGKGVVAILDA
FT                   TNSTKDRRRWIYEKCTEAGIEALFVESICDDEDLIMTNIKEVKTTSPDYKGQDPEVAAL
FT                   DFRNRIRNYEKVYETIDDDEKSYTYVKLINVGSTVIINQIKDYLSSRLVYYIQNIHIKP
FT                   RSIWLSRHGESEFNLTGRIGGDSNISERGEAYARALPELMRKSGIPDNTKIVIWTSTLR
FT                   RTIQSARHLKAETGYETLEWKALDELDSGVCDGLTYEQIAEKYPEDFAARDEDKYNYRY
FT                   RGGESYRDVVIRLEPIIMELERSENVIIVTHQAVLRCIYAYFMNVPQEQSPWMEVPLHT
FT                   LIKLTPRAYGTEEQRFKADIPAVSTWRGKGTSAKHQEFPAEGKKEDTETKN"
     MPIANFGTQS DDSKICVVMV GLPARGKSLI AGKAMRYLGW VGIPARVFNV GSYRRFSTPQ        60
     PQAGFFDPHN EEGERMRRAA AEAAMSDMLQ WFNTGKGVVA ILDATNSTKD RRRWIYEKCT       120
     EAGIEALFVE SICDDEDLIM TNIKEVKTTS PDYKGQDPEV AALDFRNRIR NYEKVYETID       180
     DDEKSYTYVK LINVGSTVII NQIKDYLSSR LVYYIQNIHI KPRSIWLSRH GESEFNLTGR       240
     IGGDSNISER GEAYARALPE LMRKSGIPDN TKIVIWTSTL RRTIQSARHL KAETGYETLE       300
     WKALDELDSG VCDGLTYEQI AEKYPEDFAA RDEDKYNYRY RGGESYRDVV IRLEPIIMEL       360
     ERSENVIIVT HQAVLRCIYA YFMNVPQEQS PWMEVPLHTL IKLTPRAYGT EEQRFKADIP       420
     AVSTWRGKGT SAKHQEFPAE GKKEDTETKN                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page