(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE158

PENCW_16.PE158       Location/Qualifiers
FT   CDS             349265..351778
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181068" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977586"
FT                   /orf_name="Pc20g01580"
FT                   /product="Pc20g01580 protein"
FT                   /protein_id="CAP85487.1"
FT                   /db_xref="InterPro:IPR013745"
FT                   /db_xref="UniParc:UPI00018312D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG5"
FT                   /transl_table=1
FT                   /translation="MNPTFRSPNSPGRQAPAPRYPRPPSDDEEEDDSDEDELVRPGSSG
FT                   SDASSNVTTVSAAPVTPINTQQPGGYFPPQPRSATSPHHPMPNPSGRRPSGRGPSVELP
FT                   RHRSRHHSQGFFEPSLPTASSDQVPTVSASRIAAQAAMQQTKKQQNVTTPVEDGSRPRR
FT                   SGSSSPPLMPAPLRVNQPSPQPPPPSGNVATTAANVVFPRAGAAPAEQQPEKQKKKKLF
FT                   SKPKHIGISSHKDLGKDRGLPSPSKISGLSRMVSGSTTNLADLSSNNSSMYNLSNASVS
FT                   TVVPADRPPIQEKEKEKDKDKHKHHFLSRQKLKLKDRVEDHFNLPLSSASSNSRPADPN
FT                   APQSLYSFTPASPAPGATFGKSVSGLDLLHGGRALREKKKEEKALAESEQMEWLANNAG
FT                   GPTTPGGFPGPSSVGSSGTLPESMLRETLQGFGLNNMTPEDAWDFLKAKLLVIFDGEDV
FT                   RIAIEDLNKLVLVHLQRCVLKRAPTSIVVDLQELLETGFATLNHSSLIGLPDEKLVPHL
FT                   VQVWLLVFGTILPFIQAVFLPLDLEFKGCGSLMTSREAGEFWGALPVGGTLDVRSLVLI
FT                   AFRDCMILNRYDALKATFSRLSLDSINSGFPTLSVTAKSTGTGGRPGTAASLDAGFGSY
FT                   TSQSSTLLSTVTDSYSSDGISALANHPRPTSSDSRSRATSNTSSNADPLFFQSITSPPT
FT                   SNKRPTVIHRGNTSADSSHVITETVGRMLQCISVLASVQTDDASQERIEILSKALKHNW
FT                   LGRGRTGRDRRGFVGAKIRPVMVGGPPVIDDGDSLTTAGISIGASTSTGGSRGRGDSSS
FT                   SEWSSNVPGPGMSMRSGGRRELSVL"
     MNPTFRSPNS PGRQAPAPRY PRPPSDDEEE DDSDEDELVR PGSSGSDASS NVTTVSAAPV        60
     TPINTQQPGG YFPPQPRSAT SPHHPMPNPS GRRPSGRGPS VELPRHRSRH HSQGFFEPSL       120
     PTASSDQVPT VSASRIAAQA AMQQTKKQQN VTTPVEDGSR PRRSGSSSPP LMPAPLRVNQ       180
     PSPQPPPPSG NVATTAANVV FPRAGAAPAE QQPEKQKKKK LFSKPKHIGI SSHKDLGKDR       240
     GLPSPSKISG LSRMVSGSTT NLADLSSNNS SMYNLSNASV STVVPADRPP IQEKEKEKDK       300
     DKHKHHFLSR QKLKLKDRVE DHFNLPLSSA SSNSRPADPN APQSLYSFTP ASPAPGATFG       360
     KSVSGLDLLH GGRALREKKK EEKALAESEQ MEWLANNAGG PTTPGGFPGP SSVGSSGTLP       420
     ESMLRETLQG FGLNNMTPED AWDFLKAKLL VIFDGEDVRI AIEDLNKLVL VHLQRCVLKR       480
     APTSIVVDLQ ELLETGFATL NHSSLIGLPD EKLVPHLVQV WLLVFGTILP FIQAVFLPLD       540
     LEFKGCGSLM TSREAGEFWG ALPVGGTLDV RSLVLIAFRD CMILNRYDAL KATFSRLSLD       600
     SINSGFPTLS VTAKSTGTGG RPGTAASLDA GFGSYTSQSS TLLSTVTDSY SSDGISALAN       660
     HPRPTSSDSR SRATSNTSSN ADPLFFQSIT SPPTSNKRPT VIHRGNTSAD SSHVITETVG       720
     RMLQCISVLA SVQTDDASQE RIEILSKALK HNWLGRGRTG RDRRGFVGAK IRPVMVGGPP       780
     VIDDGDSLTT AGISIGASTS TGGSRGRGDS SSSEWSSNVP GPGMSMRSGG RRELSVL          837
//

If you have problems or comments...

PBIL Back to PBIL home page