(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE16

PENCW_16.PE16        Location/Qualifiers
FT   CDS             48329..50347
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671388"
FT                   /orf_name="Pc20g00160"
FT                   /product="Pc20g00160 protein"
FT                   /protein_id="CAP85345.1"
FT                   /db_xref="UniParc:UPI0001831908"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF27"
FT                   /transl_table=1
FT                   /translation="MPHAHHAGLVMRNHVRRDVIPPHRLPFLVPSTSSIATELPSLVAR
FT                   AEASTTVTGEKPTSNLTTTVLPVVLGAGVPILCAIVVLIVLHRRHVKKLLREDAMDKHK
FT                   SLDFGMDTVGPATRRKGPGMPPMSEPTHTKGLSLDVGPYLMPPGLKNSPESLRSMSIDD
FT                   DKYRPATASIRSYPRGSRFEGADDGNSGLLQNAQRMSRSSPPLYSSPIESHGRSLDQHN
FT                   DYLGEVPGVTHPPAAQQPGMAIGSPNANRIPSPEPLPHLDSSLGLNFGLDNTHGNTYNN
FT                   QHEERLNFPLPEPSQSRDLDHNQAPASQLPRISLPDSVVTSSDYGDDRKSQYTLPTVNI
FT                   HGTEDVQQHNALSHDNKNPELPEEPQNLDAAYDNRRDTRRMTLGLRPLPPEDPADNPEQ
FT                   RANRIRSFYKEYFDESKNGQEPTYYEDFGPEFYEGGGNAGFIYDPITGDYYDATHGVAP
FT                   FAEPMTRRAMTPPPRAPPRFQGAARHMATNSAGYNGMPGPRAFSSASGRMPGPRGPKKP
FT                   IPPPSPLQILPTPHMLTDDSLMTAMDFAPANGFKDRRAGRPETPTGGVRHYIPGVRAHT
FT                   PLASAFDELAVMPSPHALRKSGTFTNLDFVPPPRFKNEGAGSDAGSIRSARTVVSAHHQ
FT                   NNIRMGNYRVSRLPAEAVGTKDDMMATLRPKWDMNNT"
     MPHAHHAGLV MRNHVRRDVI PPHRLPFLVP STSSIATELP SLVARAEAST TVTGEKPTSN        60
     LTTTVLPVVL GAGVPILCAI VVLIVLHRRH VKKLLREDAM DKHKSLDFGM DTVGPATRRK       120
     GPGMPPMSEP THTKGLSLDV GPYLMPPGLK NSPESLRSMS IDDDKYRPAT ASIRSYPRGS       180
     RFEGADDGNS GLLQNAQRMS RSSPPLYSSP IESHGRSLDQ HNDYLGEVPG VTHPPAAQQP       240
     GMAIGSPNAN RIPSPEPLPH LDSSLGLNFG LDNTHGNTYN NQHEERLNFP LPEPSQSRDL       300
     DHNQAPASQL PRISLPDSVV TSSDYGDDRK SQYTLPTVNI HGTEDVQQHN ALSHDNKNPE       360
     LPEEPQNLDA AYDNRRDTRR MTLGLRPLPP EDPADNPEQR ANRIRSFYKE YFDESKNGQE       420
     PTYYEDFGPE FYEGGGNAGF IYDPITGDYY DATHGVAPFA EPMTRRAMTP PPRAPPRFQG       480
     AARHMATNSA GYNGMPGPRA FSSASGRMPG PRGPKKPIPP PSPLQILPTP HMLTDDSLMT       540
     AMDFAPANGF KDRRAGRPET PTGGVRHYIP GVRAHTPLAS AFDELAVMPS PHALRKSGTF       600
     TNLDFVPPPR FKNEGAGSDA GSIRSARTVV SAHHQNNIRM GNYRVSRLPA EAVGTKDDMM       660
     ATLRPKWDMN NT                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page