(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE160

PENCW_16.PE160       Location/Qualifiers
FT   CDS             join(356424..357081,357152..359073,359137..359295)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181046" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947761"
FT                   /orf_name="Pc20g01600"
FT                   /product="Pc20g01600 protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAP85489.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI00018312D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG7"
FT                   /transl_table=1
FT                   /translation="MDHTSTPTEAKDEVVPSENLNGSAQPAEVKDVREVKDAATAPAPE
FT                   TTPASAPKLCKKHKKKNKKKDESDSSSDSSSSSSSSDSDADSEDASDSTESDSDTEKRK
FT                   RHRLRKARARRALRDKKRRKKRKQRSRKAETSDSESDSEEESDSVSSTDSDDDIDDKAL
FT                   RKLVTKLKLSKKRAKKLRELAADDLAASDSLGETRREKRSKKKKPASKVAYKRVDQLWD
FT                   TTIHKYKLTETVDDPDADEWDQYIFNIRRKFNWENKYLETVVDIKSKPLRDALSKIMDG
FT                   VKGVSLVQEPAVVDPNMLFLYLEETRQYMKDLKKQSRSEKKRKVRKAAAVKAAHLKVLI
FT                   KYLDTDYADIKKTLYPLLEANTITFDLLWALYKPNTIAYTPTYGSTDEPRAFKIEYAIK
FT                   ESSFMKGQWYSVDGRYLEYDGKDYGFGTMSAEVDSFKGARKITSLACYPLKYHRDAEAL
FT                   RARLVERGKRFVALRGMNYRFHKGMAFYKKKRSLIIKVNINGRVMIDPAIHRRINPNYP
FT                   ISTVRPKDPDLIDPEDLGISGDEGEDSDGCCCGGSDSDSEHGGASDTPRTMYKVVEDTE
FT                   GCPRVVEVEVDENGTEIHKEKMDRIEGAASGSKDREFTEEELLIASPVVLGFAFSEKLW
FT                   LEFTISGISDIEWDKEAFGSLVLPSNQKSIVKALVESHTFHAAQNIDDVIQGKGKGLVA
FT                   VLHGPPGTGKTLTAEGIAELLRRPLYMVSAGELGTDSRTLEAELNKILDIAHSWGAVLL
FT                   LDEADVFLEKRTIHDIHRNALVSIFLRLLEYFQGILFLTTNRVETFDDAFQSRIHVALR
FT                   YGDLTSKAKRSIWKMFLERVRAIEGVNIASFSEEDYDMLSRHTLNGRQIKNSVRTAQAL
FT                   AVNEKAPLSMDHIKRVLEVAETFDQDLRGGTGYLDAMRSYT"
     MDHTSTPTEA KDEVVPSENL NGSAQPAEVK DVREVKDAAT APAPETTPAS APKLCKKHKK        60
     KNKKKDESDS SSDSSSSSSS SDSDADSEDA SDSTESDSDT EKRKRHRLRK ARARRALRDK       120
     KRRKKRKQRS RKAETSDSES DSEEESDSVS STDSDDDIDD KALRKLVTKL KLSKKRAKKL       180
     RELAADDLAA SDSLGETRRE KRSKKKKPAS KVAYKRVDQL WDTTIHKYKL TETVDDPDAD       240
     EWDQYIFNIR RKFNWENKYL ETVVDIKSKP LRDALSKIMD GVKGVSLVQE PAVVDPNMLF       300
     LYLEETRQYM KDLKKQSRSE KKRKVRKAAA VKAAHLKVLI KYLDTDYADI KKTLYPLLEA       360
     NTITFDLLWA LYKPNTIAYT PTYGSTDEPR AFKIEYAIKE SSFMKGQWYS VDGRYLEYDG       420
     KDYGFGTMSA EVDSFKGARK ITSLACYPLK YHRDAEALRA RLVERGKRFV ALRGMNYRFH       480
     KGMAFYKKKR SLIIKVNING RVMIDPAIHR RINPNYPIST VRPKDPDLID PEDLGISGDE       540
     GEDSDGCCCG GSDSDSEHGG ASDTPRTMYK VVEDTEGCPR VVEVEVDENG TEIHKEKMDR       600
     IEGAASGSKD REFTEEELLI ASPVVLGFAF SEKLWLEFTI SGISDIEWDK EAFGSLVLPS       660
     NQKSIVKALV ESHTFHAAQN IDDVIQGKGK GLVAVLHGPP GTGKTLTAEG IAELLRRPLY       720
     MVSAGELGTD SRTLEAELNK ILDIAHSWGA VLLLDEADVF LEKRTIHDIH RNALVSIFLR       780
     LLEYFQGILF LTTNRVETFD DAFQSRIHVA LRYGDLTSKA KRSIWKMFLE RVRAIEGVNI       840
     ASFSEEDYDM LSRHTLNGRQ IKNSVRTAQA LAVNEKAPLS MDHIKRVLEV AETFDQDLRG       900
     GTGYLDAMRS YT                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page