(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE161

PENCW_16.PE161       Location/Qualifiers
FT   CDS             join(complement(360795..360860),complement(360624..360741),
FT                   complement(360323..360567),complement(359670..360263))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947762"
FT                   /orf_name="Pc20g01610"
FT                   /product="Pc20g01610 protein"
FT                   /function="L-malate dehydrogenase activity"
FT                   /function="binding"
FT                   /biological_process="glycolysis"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85490.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0030060"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniParc:UPI00018312D5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG8"
FT                   /transl_table=1
FT                   /translation="MFAARRTVNLFQKRAFSASAINASKVSVLGAAGGIGQPLSLLLKL
FT                   NPRVSELALYDIRGGPGVAADLSHINTNSTVTGYNPDASGLRDCLEGSEIILIPAGVPR
FT                   KPGMTRDDLFNTNASIVRDLAKAAAEAAPKAHVLVIANPVNSTVPIVAEVYKARNVYDP
FT                   KRLFGVTTLDVVRASRFISQVQNTNPAGEAVPVVGGHSGVTIVPLLSQSNHSSIAGQAR
FT                   DALVNRIQFGGDEVVKAKDGAGSATLSMAMAGARFAESLLRAAQGEKGVIEPTFVDSPL
FT                   YKDQGIDFFASRVELGPNGVEKINSVGEVNEYEQGLLDACLTDLKKNIQKGVDFVKANP
FT                   "
     MFAARRTVNL FQKRAFSASA INASKVSVLG AAGGIGQPLS LLLKLNPRVS ELALYDIRGG        60
     PGVAADLSHI NTNSTVTGYN PDASGLRDCL EGSEIILIPA GVPRKPGMTR DDLFNTNASI       120
     VRDLAKAAAE AAPKAHVLVI ANPVNSTVPI VAEVYKARNV YDPKRLFGVT TLDVVRASRF       180
     ISQVQNTNPA GEAVPVVGGH SGVTIVPLLS QSNHSSIAGQ ARDALVNRIQ FGGDEVVKAK       240
     DGAGSATLSM AMAGARFAES LLRAAQGEKG VIEPTFVDSP LYKDQGIDFF ASRVELGPNG       300
     VEKINSVGEV NEYEQGLLDA CLTDLKKNIQ KGVDFVKANP                             340
//

If you have problems or comments...

PBIL Back to PBIL home page