(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE162

PENCW_16.PE162       Location/Qualifiers
FT   CDS             join(complement(362604..362606),complement(362457..362556),
FT                   complement(362219..362400),complement(361720..362163))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217458" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947763"
FT                   /orf_name="Pc20g01620"
FT                   /product="Pc20g01620 protein"
FT                   /protein_id="CAP85491.1"
FT                   /db_xref="UniParc:UPI00018312D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG9"
FT                   /transl_table=1
FT                   /translation="MNSLFNSALKQSSSIRRDLDTFSQSPTTSSPALQGQLAASLASLS
FT                   RTVDDYSALSKKELIPEKQQKAFDRVKNFRNELMDYRTQFDRLRKEREDAQSVTNHNEL
FT                   LGRRPHHTATPENPYAQSSLPQSTSAFTPSSSDLGFGASPADYNRETNALREQSFFSNT
FT                   HNQLDDFLDRGRAVLADLGQQREVLKGTQRRLYSVANTLGVSGDTIRMVERRARQDKWI
FT                   FWGGVVIFFLFCWAVLHFLR"
     MNSLFNSALK QSSSIRRDLD TFSQSPTTSS PALQGQLAAS LASLSRTVDD YSALSKKELI        60
     PEKQQKAFDR VKNFRNELMD YRTQFDRLRK EREDAQSVTN HNELLGRRPH HTATPENPYA       120
     QSSLPQSTSA FTPSSSDLGF GASPADYNRE TNALREQSFF SNTHNQLDDF LDRGRAVLAD       180
     LGQQREVLKG TQRRLYSVAN TLGVSGDTIR MVERRARQDK WIFWGGVVIF FLFCWAVLHF       240
     LR                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page