(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE163

PENCW_16.PE163       Location/Qualifiers
FT   CDS             join(complement(365916..366025),complement(365808..365857),
FT                   complement(365524..365747),complement(364396..365462),
FT                   complement(363737..363859),complement(363252..363663))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000281566" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947764"
FT                   /orf_name="Pc20g01630"
FT                   /product="Pc20g01630 protein"
FT                   /function="dihydrolipoyllysine-residue acetyltransferase
FT                   activity"
FT                   /biological_process="pyruvate metabolic process "
FT                   /cellular_component="pyruvate dehydrogenase complex "
FT                   /protein_id="CAP85492.1"
FT                   /db_xref="GO:0004742"
FT                   /db_xref="GO:0006090"
FT                   /db_xref="GO:0045254"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI00018312D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH0"
FT                   /transl_table=1
FT                   /translation="MVASAIRMRTPSAMFMSRGAAAMRRPQVSSKLQEVIQTQVPALSA
FT                   LSRFYASKSFPPHTLISMPALSPTMTAGNIGVWQKKAGDALQPGDVLVEIETDKAQMDF
FT                   EFQDEGVLAKVLKESGEKDVSVGSPIAVLVEEGSDVSAFESFTLADAGGDKPAPTEQKE
FT                   EPKSAEPSTPAPAEEAPAAQEPETSGEKLQPSLDREPSISPAAKVLALEKGVSIKGLKG
FT                   TGRGGVITKEDVEKAKPATTAVSGEATFEEIPVSSMRKTIANRLKQSMTENPHYFVSTT
FT                   LSVTKLLKLRQALNASADGQYKLSVNDFLVKACAVALLKVPQVNSSWREENGQAVIRQH
FT                   KTADISVAVSTPTGLITPVVKNVQGLGLSSISKQVKDLGKRARENKLKPEEYQGGTFTI
FT                   SNMGMNAAVERFTAVINPPQAGILAVGTTRKVAIPVETEEGTVTEWDDQIIVTGSFDHK
FT                   VVDGAVGGEWIKELKKVVENPLELLLISPDYVLIPSRTNMSYADAAAKGPKQSPEDVRI
FT                   QTRIFTLRRAPPVGGIYRDESESTASLIDVDGPHVQTVESDFLKHDVQTTTQAERIDRE
FT                   AEEKEKREDEEKKKARSQKAKSSGICGNTSNPVFIANAAIATVVGAGLGFGVYKQHARG
FT                   NLSWELVGLSAGAVGIFGAVDYFVSK"
     MVASAIRMRT PSAMFMSRGA AAMRRPQVSS KLQEVIQTQV PALSALSRFY ASKSFPPHTL        60
     ISMPALSPTM TAGNIGVWQK KAGDALQPGD VLVEIETDKA QMDFEFQDEG VLAKVLKESG       120
     EKDVSVGSPI AVLVEEGSDV SAFESFTLAD AGGDKPAPTE QKEEPKSAEP STPAPAEEAP       180
     AAQEPETSGE KLQPSLDREP SISPAAKVLA LEKGVSIKGL KGTGRGGVIT KEDVEKAKPA       240
     TTAVSGEATF EEIPVSSMRK TIANRLKQSM TENPHYFVST TLSVTKLLKL RQALNASADG       300
     QYKLSVNDFL VKACAVALLK VPQVNSSWRE ENGQAVIRQH KTADISVAVS TPTGLITPVV       360
     KNVQGLGLSS ISKQVKDLGK RARENKLKPE EYQGGTFTIS NMGMNAAVER FTAVINPPQA       420
     GILAVGTTRK VAIPVETEEG TVTEWDDQII VTGSFDHKVV DGAVGGEWIK ELKKVVENPL       480
     ELLLISPDYV LIPSRTNMSY ADAAAKGPKQ SPEDVRIQTR IFTLRRAPPV GGIYRDESES       540
     TASLIDVDGP HVQTVESDFL KHDVQTTTQA ERIDREAEEK EKREDEEKKK ARSQKAKSSG       600
     ICGNTSNPVF IANAAIATVV GAGLGFGVYK QHARGNLSWE LVGLSAGAVG IFGAVDYFVS       660
     K                                                                       661
//

If you have problems or comments...

PBIL Back to PBIL home page