(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE164

PENCW_16.PE164       Location/Qualifiers
FT   CDS             join(366479..366631,366747..368536,368588..370863,
FT                   370914..372300,372364..372700)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947765"
FT                   /orf_name="Pc20g01640"
FT                   /product="Pc20g01640 protein"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /function="binding"
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85493.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR015403"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018313A7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDP9"
FT                   /transl_table=1
FT                   /translation="MDMYITLNVHALLYVCLQNQTMSILPGKRGAVRTLESPTPAGTRG
FT                   SIILAEITPPGVSLTMADTELGSEPTQSIEMPKKPVETPDISPTVPNSDEPALPEQTEP
FT                   QEPVQKGDEEVPKGQDDEEKPEVPPKDEPEQTEQEPQTDGPPTIQEPPQDDNDATESRL
FT                   RSDSRSTTATFMTQRSSPVSSTVFIVTALDNIAASRDARRDKKLEDATQVALANIRQPD
FT                   GQAIDPELIFRPLHLASKALSIPLQVTALDCIGKLITYSYFAFPSAETENNATREQPPL
FT                   IERAIDAICDCFENEATAVEIQQQIIKSLLAAVLNDKIVVHGAGLLKAVRQIYNIFIYS
FT                   KSSQNQQIAQGSLTQMVSTVFDRVRTRMDLKELRVRELEKPSSTLDASASDVGQTSETA
FT                   SMPVADQPVTKEPTTEKLTLQSFESPKEVTGVNDNAPTTVTRAKRSATRSMSGIPEEKD
FT                   DDSSAEDDVDEIYVKDAFLVFRALCKLSHKVLTHEQQQDVKSQNMRSKLLSLHLIHYLI
FT                   NNHTATFISPLAAIKNSSSSADGMNLLLAVRPHLCLSLSRNGSSAVPHIFKVCCEIFWL
FT                   MLKDMRVMMKKELEVFLKEIYLAILEKRGAPAFQKQYFMEILERLGGDPRALVEIYLNY
FT                   DCDRTALENIFQNIIEQLSRYSSVPVVTTPSQQHQYQEQHTKMSAIGSEWHHRGTLPPS
FT                   LTSAHIVPTPPPSMPHIPSEYGLKQQALECLVEILRSLDNWATHRIDEQPEAAMPSKSM
FT                   DNSRESLDTSVLVSPHPETLEGGTGRSTPMPEDDPNQIEKVKQRKIALTNAIQQFNFKP
FT                   KRGIKALLKEGFIQSESPEDIASFMLRTDRIDKAVLGEYLGEGDPENIAIMHAFVDLME
FT                   FTKRRFVESLRSFLQHFRLPGEAQKIDRFMLKFAERYTTQNPNAFANADTAYVLAYSVI
FT                   LLNTDQHSSKMKGRRMTKEDFIKNNRGINDNQDLPTDYLGAIYEDIGSNEIVLYTEQEH
FT                   AANLNPQPAAPTGLATRAGQVFATVGRDIQGEKYAQASEEMANKTEQLYRSLIRAQRKT
FT                   AVKDALSHFIPATSERHVGSMFNVTWMSFLSGLSAPMQDTSNLETIRLCMEGLKLSIRI
FT                   SCAFDLETPRVAFVTALAKFTNLGNVREMMAKNVEALKALLDVAFTEGNHLQGSWRDVL
FT                   TCVSQLDRLQLLSDGVDEGSLPDVSRAPSSADTSRRSMQSTRRARPRSVNGPTAFRPEI
FT                   AMESRSADMIRGVDRIFTNTANLSHEAIIDFVRALSEVSWQEIQSSGHTDSPRTYSLQK
FT                   LVEISYYNMTRVRIEWSKIWDVLGQHFNQVGCHSNTMVVFFALDSLRQLSMRFMEIEEL
FT                   PGFKFQKDFLKPFEHVMANSTTAAVKDMILRCLIQMIQARGDNIRSGWKTMFGVFTVAA
FT                   REPYEGIVNMAFDHVTQVYNTRFGVVITQGAFADLIVCLTEFSKNSKFQKKSLQAIETL
FT                   RSTVTKMLRTPECPLSHRGASAATFQDNGTNLAKQLTRQSQEEQFWYPILIAFQDVLMT
FT                   GDDLEVRSRALTYLFDTLIRHGGDFPRDFWDVLWRQLLYPIFVVLQSKSEMSKVPNHED
FT                   LSVWLSTTMIQALRNMITLFTHYFDALEYMLSRFLELLTLCICQENDTIARIGSNCLQQ
FT                   LILQNVAKFKQEHWSQIVGAFVELFSKTTAYELFTAAVSMSKPAEAVNGDLTQSPDAAV
FT                   ATSDLPDALQPNGSQSTSSIHDGGDPPVQSEARAELEDYRPQSDQQQPAAVTAARRRYF
FT                   NRIITNCVLQLLMIETVHELFSNENVYAQIPSGELLRLMGLLKKSYQFAKKFNEDKDLR
FT                   MQLWRQGFMKQPPNLLKQESGSASTYVRILFRMYHDEREERQSSRAETEAALIPLCADI
FT                   IRSFVRLEEDTQHRNIVAWRPVVVDVIDGYTNFPQDDFNNHIETFYPLGVELLSRDLNP
FT                   EIRVALQSLLRRIGEVRLGIAPPNPLDVPISPRSSVSQKVPRRDSQV"
     MDMYITLNVH ALLYVCLQNQ TMSILPGKRG AVRTLESPTP AGTRGSIILA EITPPGVSLT        60
     MADTELGSEP TQSIEMPKKP VETPDISPTV PNSDEPALPE QTEPQEPVQK GDEEVPKGQD       120
     DEEKPEVPPK DEPEQTEQEP QTDGPPTIQE PPQDDNDATE SRLRSDSRST TATFMTQRSS       180
     PVSSTVFIVT ALDNIAASRD ARRDKKLEDA TQVALANIRQ PDGQAIDPEL IFRPLHLASK       240
     ALSIPLQVTA LDCIGKLITY SYFAFPSAET ENNATREQPP LIERAIDAIC DCFENEATAV       300
     EIQQQIIKSL LAAVLNDKIV VHGAGLLKAV RQIYNIFIYS KSSQNQQIAQ GSLTQMVSTV       360
     FDRVRTRMDL KELRVRELEK PSSTLDASAS DVGQTSETAS MPVADQPVTK EPTTEKLTLQ       420
     SFESPKEVTG VNDNAPTTVT RAKRSATRSM SGIPEEKDDD SSAEDDVDEI YVKDAFLVFR       480
     ALCKLSHKVL THEQQQDVKS QNMRSKLLSL HLIHYLINNH TATFISPLAA IKNSSSSADG       540
     MNLLLAVRPH LCLSLSRNGS SAVPHIFKVC CEIFWLMLKD MRVMMKKELE VFLKEIYLAI       600
     LEKRGAPAFQ KQYFMEILER LGGDPRALVE IYLNYDCDRT ALENIFQNII EQLSRYSSVP       660
     VVTTPSQQHQ YQEQHTKMSA IGSEWHHRGT LPPSLTSAHI VPTPPPSMPH IPSEYGLKQQ       720
     ALECLVEILR SLDNWATHRI DEQPEAAMPS KSMDNSRESL DTSVLVSPHP ETLEGGTGRS       780
     TPMPEDDPNQ IEKVKQRKIA LTNAIQQFNF KPKRGIKALL KEGFIQSESP EDIASFMLRT       840
     DRIDKAVLGE YLGEGDPENI AIMHAFVDLM EFTKRRFVES LRSFLQHFRL PGEAQKIDRF       900
     MLKFAERYTT QNPNAFANAD TAYVLAYSVI LLNTDQHSSK MKGRRMTKED FIKNNRGIND       960
     NQDLPTDYLG AIYEDIGSNE IVLYTEQEHA ANLNPQPAAP TGLATRAGQV FATVGRDIQG      1020
     EKYAQASEEM ANKTEQLYRS LIRAQRKTAV KDALSHFIPA TSERHVGSMF NVTWMSFLSG      1080
     LSAPMQDTSN LETIRLCMEG LKLSIRISCA FDLETPRVAF VTALAKFTNL GNVREMMAKN      1140
     VEALKALLDV AFTEGNHLQG SWRDVLTCVS QLDRLQLLSD GVDEGSLPDV SRAPSSADTS      1200
     RRSMQSTRRA RPRSVNGPTA FRPEIAMESR SADMIRGVDR IFTNTANLSH EAIIDFVRAL      1260
     SEVSWQEIQS SGHTDSPRTY SLQKLVEISY YNMTRVRIEW SKIWDVLGQH FNQVGCHSNT      1320
     MVVFFALDSL RQLSMRFMEI EELPGFKFQK DFLKPFEHVM ANSTTAAVKD MILRCLIQMI      1380
     QARGDNIRSG WKTMFGVFTV AAREPYEGIV NMAFDHVTQV YNTRFGVVIT QGAFADLIVC      1440
     LTEFSKNSKF QKKSLQAIET LRSTVTKMLR TPECPLSHRG ASAATFQDNG TNLAKQLTRQ      1500
     SQEEQFWYPI LIAFQDVLMT GDDLEVRSRA LTYLFDTLIR HGGDFPRDFW DVLWRQLLYP      1560
     IFVVLQSKSE MSKVPNHEDL SVWLSTTMIQ ALRNMITLFT HYFDALEYML SRFLELLTLC      1620
     ICQENDTIAR IGSNCLQQLI LQNVAKFKQE HWSQIVGAFV ELFSKTTAYE LFTAAVSMSK      1680
     PAEAVNGDLT QSPDAAVATS DLPDALQPNG SQSTSSIHDG GDPPVQSEAR AELEDYRPQS      1740
     DQQQPAAVTA ARRRYFNRII TNCVLQLLMI ETVHELFSNE NVYAQIPSGE LLRLMGLLKK      1800
     SYQFAKKFNE DKDLRMQLWR QGFMKQPPNL LKQESGSAST YVRILFRMYH DEREERQSSR      1860
     AETEAALIPL CADIIRSFVR LEEDTQHRNI VAWRPVVVDV IDGYTNFPQD DFNNHIETFY      1920
     PLGVELLSRD LNPEIRVALQ SLLRRIGEVR LGIAPPNPLD VPISPRSSVS QKVPRRDSQV      1980
//

If you have problems or comments...

PBIL Back to PBIL home page