(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE165

PENCW_16.PE165       Location/Qualifiers
FT   CDS             join(complement(373601..373693),complement(373047..373528),
FT                   complement(372863..372992))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128696"
FT                   /orf_name="Pc20g01650"
FT                   /product="Pc20g01650 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="CAP85494.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018313A8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ0"
FT                   /transl_table=1
FT                   /translation="MSKFPEVQGGGSLIIAWQIRDKHVLVVGGGEVAAGRILHALNADA
FT                   RVTVVCPAAGLNEEVNFRVTEKQVTHIDRNFEPSDLDNVDMVLCAIDDPEASTQVWKLC
FT                   KERRIIANIADVPPECDFYFGSVHRDGPLQVMVSTNGNGPKLASIVRKKISETLPTNMG
FT                   AAIENVGKLRKKLREVAPNPDQGPKRMKWMSGVCETWSLDELVQMTEEDMDSVLSFYES
FT                   GKIPALEEVRNK"
     MSKFPEVQGG GSLIIAWQIR DKHVLVVGGG EVAAGRILHA LNADARVTVV CPAAGLNEEV        60
     NFRVTEKQVT HIDRNFEPSD LDNVDMVLCA IDDPEASTQV WKLCKERRII ANIADVPPEC       120
     DFYFGSVHRD GPLQVMVSTN GNGPKLASIV RKKISETLPT NMGAAIENVG KLRKKLREVA       180
     PNPDQGPKRM KWMSGVCETW SLDELVQMTE EDMDSVLSFY ESGKIPALEE VRNK             234
//

If you have problems or comments...

PBIL Back to PBIL home page