(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE166

PENCW_16.PE166       Location/Qualifiers
FT   CDS             join(373867..374132,374249..374369,374424..375506)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128697"
FT                   /orf_name="Pc20g01660"
FT                   /product="Pc20g01660 protein"
FT                   /function="magnesium ion binding"
FT                   /function="ribose phosphate diphosphokinase activity "
FT                   /biological_process="ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="CAP85495.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004749"
FT                   /db_xref="GO:0009156"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="UniParc:UPI00018313A9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ1"
FT                   /transl_table=1
FT                   /translation="MRGVQIFSGNSHPGLADTICERLGTVPAKANLGKFANGETSVNIG
FT                   TSVRNQDVYIIQSGSEKINDSVMELLIMISACKGGSAKSITGMLYFPYSRQSKKKSHRG
FT                   AITARMLANLLTIAGVDHVITMDLHASQMQGFFGKPVDNLFAEPFIARWIRMNVPGWKD
FT                   AVVVSKNAGGTKRVTSLADTLKLNFGIVTTDRRRPKVPVATMTDSTVFFDAVDEDPIPT
FT                   EDAQPFELRMQGYNRTTATPPIPEEQEPITPPPARYLLRPETPPAARRPSELEAAYEYT
FT                   DVRVRDVITGRLVQGQLVDDDYRANEDSQSGGTTPGAGSSSHDNTETIPDAMVNSIVSN
FT                   ASSQPDHALGGSFDAVESDDEASVCAGQVDERTITLVGEVRDRSVFLVDDMIDKSGSWI
FT                   AAAETVVKRGGASKVYCIATHGLFGENSLDQMEACPSIDHIVVTNTFPISPSMLRRSKK
FT                   LIVIDVSSLLAESMRRHHYGERFVFTDPGVV"
     MRGVQIFSGN SHPGLADTIC ERLGTVPAKA NLGKFANGET SVNIGTSVRN QDVYIIQSGS        60
     EKINDSVMEL LIMISACKGG SAKSITGMLY FPYSRQSKKK SHRGAITARM LANLLTIAGV       120
     DHVITMDLHA SQMQGFFGKP VDNLFAEPFI ARWIRMNVPG WKDAVVVSKN AGGTKRVTSL       180
     ADTLKLNFGI VTTDRRRPKV PVATMTDSTV FFDAVDEDPI PTEDAQPFEL RMQGYNRTTA       240
     TPPIPEEQEP ITPPPARYLL RPETPPAARR PSELEAAYEY TDVRVRDVIT GRLVQGQLVD       300
     DDYRANEDSQ SGGTTPGAGS SSHDNTETIP DAMVNSIVSN ASSQPDHALG GSFDAVESDD       360
     EASVCAGQVD ERTITLVGEV RDRSVFLVDD MIDKSGSWIA AAETVVKRGG ASKVYCIATH       420
     GLFGENSLDQ MEACPSIDHI VVTNTFPISP SMLRRSKKLI VIDVSSLLAE SMRRHHYGER       480
     FVFTDPGVV                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page