(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE167

PENCW_16.PE167       Location/Qualifiers
FT   CDS             join(378412..378544,378687..378976)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947766"
FT                   /orf_name="Pc20g01670"
FT                   /product="Pc20g01670 protein"
FT                   /protein_id="CAP85496.1"
FT                   /db_xref="UniParc:UPI00018313AA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ2"
FT                   /transl_table=1
FT                   /translation="MANQCSGHVFAIVQATNGNILTWRCSDCNSGPFVAIWRCKICGHY
FT                   ICICFLSISSTDLLLCMNPVQGYFPLGAGLPAHFVAFVWRVFVHLMCSKSPQKFLMHLH
FT                   LASGGVIDRFPPPLSHSSYSLFYYGYVFYILDLDFP"
     MANQCSGHVF AIVQATNGNI LTWRCSDCNS GPFVAIWRCK ICGHYICICF LSISSTDLLL        60
     CMNPVQGYFP LGAGLPAHFV AFVWRVFVHL MCSKSPQKFL MHLHLASGGV IDRFPPPLSH       120
     SSYSLFYYGY VFYILDLDFP                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page