(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE17

PENCW_16.PE17        Location/Qualifiers
FT   CDS             51962..53227
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000187686" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977328"
FT                   /orf_name="Pc20g00170"
FT                   /product="Pc20g00170 protein"
FT                   /protein_id="CAP85346.1"
FT                   /db_xref="UniParc:UPI0001831909"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF28"
FT                   /transl_table=1
FT                   /translation="MASPSKAAGAAAAAAAIASSAAETVVQTSGSPETSSETSAAQPST
FT                   SSTETTSSSAPAPTTSSSTEPTTTSSTTSSTSSTPTTEPTTSTPDPTSTSPTSTSTSST
FT                   SSSTSSTSSTSSTTTAPSTTSSEEKTTFTSTEGTTVVVVTSTQIASNTGATSTTSSSAT
FT                   DSAALATSGTAAGSGGLSPSGTIAVAVVVPVVSVALIILALLFFWRKRKANKAAEEERR
FT                   KEVEEYGFNPNNDPTLPGIGGVVVPKDDESSGYRGWGTTSAGRKASTNLSSGMGGLAMS
FT                   EGSSPGYHHAATPSEGTVQYSDGARPDSGEIVEPIGVLGAAPVAANNRNGDIHRGPSNA
FT                   SSAYSAANRSDASEESHMSAVHPSAGYYGENPYYGDINTHGAYGGDDYQPVIRDVQARR
FT                   NTRIENPGVYPRQGNAGIAQNF"
     MASPSKAAGA AAAAAAIASS AAETVVQTSG SPETSSETSA AQPSTSSTET TSSSAPAPTT        60
     SSSTEPTTTS STTSSTSSTP TTEPTTSTPD PTSTSPTSTS TSSTSSSTSS TSSTSSTTTA       120
     PSTTSSEEKT TFTSTEGTTV VVVTSTQIAS NTGATSTTSS SATDSAALAT SGTAAGSGGL       180
     SPSGTIAVAV VVPVVSVALI ILALLFFWRK RKANKAAEEE RRKEVEEYGF NPNNDPTLPG       240
     IGGVVVPKDD ESSGYRGWGT TSAGRKASTN LSSGMGGLAM SEGSSPGYHH AATPSEGTVQ       300
     YSDGARPDSG EIVEPIGVLG AAPVAANNRN GDIHRGPSNA SSAYSAANRS DASEESHMSA       360
     VHPSAGYYGE NPYYGDINTH GAYGGDDYQP VIRDVQARRN TRIENPGVYP RQGNAGIAQN       420
     F                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page