(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE171

PENCW_16.PE171       Location/Qualifiers
FT   CDS             join(complement(391090..391409),complement(388623..390954))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168785" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128698"
FT                   /orf_name="Pc20g01710"
FT                   /product="Pc20g01710 protein"
FT                   /function="sulfuric ester hydrolase activity"
FT                   /protein_id="CAP85500.1"
FT                   /db_xref="GO:0008484"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI00018313AE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ6"
FT                   /transl_table=1
FT                   /translation="MKVVHAVHAYLSHGIRRVRLSPGETLDAIWDFSRRYFFTLAFLSL
FT                   FSAKILHLYAHIYSLPLPRLFLWGLTFFFQDVMILLLFRILAQKVAWRPGAALLAILVI
FT                   PSSLLVSFMAAANTSFYVFTGAEIHWRQAKSFNGDAAAIHTLLTGLTGFLIVEGILLTL
FT                   SLFAAHSIHAITGGILHVWAWPVRWLFARVRPHVEPLVRRFWPSKSPDLPDPRIYEQID
FT                   MEDNDSDNEEGDHLLNTGAQLPNRLPESKRVTDGVPQRALILGLFSLFLFLRFMRPWDQ
FT                   VYMYMSTTLPLTTVIEGAERHSPVVTTGTPGLFEYLDGVTALGPAPRWSWMSKEPIAGF
FT                   DDWDQSDPLALHYNPHEDPLHISNLNKPVLEEIHNALASGDVKIKHVVFLKLESARADI
FT                   FPLQKDSFMYKRIAETWKDKTIPPEVVDRLANLTRTAEYLTNFPNGFEHDDARFNGRKA
FT                   YGGISAKNAITSATYTLKSLTGSFCGVTPLVADFNREFDHHIYQPCLPHVFDMLSQQSD
FT                   ITNDTDDFTKWPWHSTFMMSVTEMYDNQDKLTPQLGFRDKQTKETIIKPEAKHYPVTSP
FT                   EVNYYGYPESELREYIRDAIDDAERDHQRLFLSHLTSTTHHPWGVPNDAYEDLMGSKSG
FT                   ANNDMNRYLNSVGYVDDWLSDLIDILEEKGVANETLFVMAGDHGLSLPNDGGITPYDNP
FT                   HIGSFKVPIVIAHPQLPPVQIDTPVINTQIVPTIIDLLIESASLSKDSTTAARDIRSLY
FT                   EGQSLIRPQVVQQDGRESWHFTVMNTGGSWLSVRSAARPEFRLVIPLVNDVEWRFSDVS
FT                   KDPNELNPIERFSLADLAAAVNKEYDDEEILNWLYNAAYVTNWWVTENWDRWRFSPKAT
FT                   EEAKEEVKEDKT"
     MKVVHAVHAY LSHGIRRVRL SPGETLDAIW DFSRRYFFTL AFLSLFSAKI LHLYAHIYSL        60
     PLPRLFLWGL TFFFQDVMIL LLFRILAQKV AWRPGAALLA ILVIPSSLLV SFMAAANTSF       120
     YVFTGAEIHW RQAKSFNGDA AAIHTLLTGL TGFLIVEGIL LTLSLFAAHS IHAITGGILH       180
     VWAWPVRWLF ARVRPHVEPL VRRFWPSKSP DLPDPRIYEQ IDMEDNDSDN EEGDHLLNTG       240
     AQLPNRLPES KRVTDGVPQR ALILGLFSLF LFLRFMRPWD QVYMYMSTTL PLTTVIEGAE       300
     RHSPVVTTGT PGLFEYLDGV TALGPAPRWS WMSKEPIAGF DDWDQSDPLA LHYNPHEDPL       360
     HISNLNKPVL EEIHNALASG DVKIKHVVFL KLESARADIF PLQKDSFMYK RIAETWKDKT       420
     IPPEVVDRLA NLTRTAEYLT NFPNGFEHDD ARFNGRKAYG GISAKNAITS ATYTLKSLTG       480
     SFCGVTPLVA DFNREFDHHI YQPCLPHVFD MLSQQSDITN DTDDFTKWPW HSTFMMSVTE       540
     MYDNQDKLTP QLGFRDKQTK ETIIKPEAKH YPVTSPEVNY YGYPESELRE YIRDAIDDAE       600
     RDHQRLFLSH LTSTTHHPWG VPNDAYEDLM GSKSGANNDM NRYLNSVGYV DDWLSDLIDI       660
     LEEKGVANET LFVMAGDHGL SLPNDGGITP YDNPHIGSFK VPIVIAHPQL PPVQIDTPVI       720
     NTQIVPTIID LLIESASLSK DSTTAARDIR SLYEGQSLIR PQVVQQDGRE SWHFTVMNTG       780
     GSWLSVRSAA RPEFRLVIPL VNDVEWRFSD VSKDPNELNP IERFSLADLA AAVNKEYDDE       840
     EILNWLYNAA YVTNWWVTEN WDRWRFSPKA TEEAKEEVKE DKT                         883
//

If you have problems or comments...

PBIL Back to PBIL home page