(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE172

PENCW_16.PE172       Location/Qualifiers
FT   CDS             391965..393164
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076722" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947768"
FT                   /orf_name="Pc20g01720"
FT                   /product="Pc20g01720 protein"
FT                   /protein_id="CAP85501.1"
FT                   /db_xref="UniParc:UPI00018313AF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ7"
FT                   /transl_table=1
FT                   /translation="MLGSLFGWVSLLFEPLAFQVPLIEPQPRLKSENGIAIPVQGPWQD
FT                   IITGHYAVPPVLKIHDRNSVVKWSWQREDVTQPLPPLIRSGLYSGYNDATDMKWMRGGR
FT                   SVAAVYSALVVVINHTPDQPSTDKKITFAINRANDVLHNAHTIEPLPGDRLAVGTTGQR
FT                   PWDGILVYNMSEALPLMDEPPVLQRIEGLRAIHALIWDEQGQMLWATGTDAAADGSDPV
FT                   PAYGVIQGYPFDAETGLLSIDEAYRFKFPEYFDIDAEWGHGYSWWAGPHDLVPVPNERV
FT                   LLVSNDIGLHAFDINEMNFTAEYDEVVEKYMPGFEVTTNDRHGINRQGEYVELPQSDLK
FT                   GFSLAPDGSFLYTQSLWRLFRGNYTSLVVDGVRHQIMKGNEIYRSRWFGDIDGWPKPKT
FT                   "
     MLGSLFGWVS LLFEPLAFQV PLIEPQPRLK SENGIAIPVQ GPWQDIITGH YAVPPVLKIH        60
     DRNSVVKWSW QREDVTQPLP PLIRSGLYSG YNDATDMKWM RGGRSVAAVY SALVVVINHT       120
     PDQPSTDKKI TFAINRANDV LHNAHTIEPL PGDRLAVGTT GQRPWDGILV YNMSEALPLM       180
     DEPPVLQRIE GLRAIHALIW DEQGQMLWAT GTDAAADGSD PVPAYGVIQG YPFDAETGLL       240
     SIDEAYRFKF PEYFDIDAEW GHGYSWWAGP HDLVPVPNER VLLVSNDIGL HAFDINEMNF       300
     TAEYDEVVEK YMPGFEVTTN DRHGINRQGE YVELPQSDLK GFSLAPDGSF LYTQSLWRLF       360
     RGNYTSLVVD GVRHQIMKGN EIYRSRWFGD IDGWPKPKT                              399
//

If you have problems or comments...

PBIL Back to PBIL home page