(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE173

PENCW_16.PE173       Location/Qualifiers
FT   CDS             join(394968..395480,395537..395915,395972..396160,
FT                   396333..396394,396460..396651)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947769"
FT                   /orf_name="Pc20g01730"
FT                   /product="Pc20g01730 protein"
FT                   /protein_id="CAP85502.1"
FT                   /db_xref="UniParc:UPI00018313B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ8"
FT                   /transl_table=1
FT                   /translation="MASSSAPSLANLAFDEICRQLEVFVAGKKASASFVCGGLVPIDAH
FT                   TAASSIPSKTTVSPPVRICWRTDADNILRELTLPLDSQADSKAESGLRQLVVDCEPASF
FT                   GKGQQDVLDPKYRKAGKLEPRSFLTSFHPSDLGILQNVEQILLPNFNTDLENRLPFRKM
FT                   HAELYKLNVYSGPSGLFRKHVDTPRSETQIGSLVVCLPSHFKGGNLVVQHEGKRVEFDW
FT                   SHQSASAIQWAAFYSDCEHEIKTITEGERITLTYNLYVTEPVGGSIPPSLIVDPKSMSL
FT                   YSFLEELLVEPGFMTDGGALGFFCSHAYPHASDEAPMLLPRALKGSDLVLYSVFKSLGI
FT                   QIDVLPVAFDDHYDQCKEKHVLVGDQLHPYFATDEIEEDESMTELCFPGEYRPEITWIG
FT                   SPTHRQEAVSYIAYGNQPSLGAVYSYAALIANIPPFLERQGLVLA"
     MASSSAPSLA NLAFDEICRQ LEVFVAGKKA SASFVCGGLV PIDAHTAASS IPSKTTVSPP        60
     VRICWRTDAD NILRELTLPL DSQADSKAES GLRQLVVDCE PASFGKGQQD VLDPKYRKAG       120
     KLEPRSFLTS FHPSDLGILQ NVEQILLPNF NTDLENRLPF RKMHAELYKL NVYSGPSGLF       180
     RKHVDTPRSE TQIGSLVVCL PSHFKGGNLV VQHEGKRVEF DWSHQSASAI QWAAFYSDCE       240
     HEIKTITEGE RITLTYNLYV TEPVGGSIPP SLIVDPKSMS LYSFLEELLV EPGFMTDGGA       300
     LGFFCSHAYP HASDEAPMLL PRALKGSDLV LYSVFKSLGI QIDVLPVAFD DHYDQCKEKH       360
     VLVGDQLHPY FATDEIEEDE SMTELCFPGE YRPEITWIGS PTHRQEAVSY IAYGNQPSLG       420
     AVYSYAALIA NIPPFLERQG LVLA                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page