(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE174

PENCW_16.PE174       Location/Qualifiers
FT   CDS             join(complement(397968..398002),complement(397195..397798))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947770"
FT                   /orf_name="Pc20g01740"
FT                   /product="Pc20g01740 protein"
FT                   /protein_id="CAP85503.1"
FT                   /db_xref="UniParc:UPI00018313B1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ9"
FT                   /transl_table=1
FT                   /translation="MPDWEVEDSHRCAPCKMNRTAFFSSSIINNGSSNRQSCISFSLRP
FT                   APWDSAKILVHPSGYPIEAPPMYSIISKDSPPNVVLLRGWGEGPWVIVGDARLPTLSSK
FT                   IHLTFYGQPIIMRLNQLSGNYALESPAVGQLKWRPDMFTGRDMQLQDATGRKLAKLRPG
FT                   KSGEKLLEILVSHDSSFSEIVLLSGWTARAMTKSVTEATGEILSSVVGA"
     MPDWEVEDSH RCAPCKMNRT AFFSSSIINN GSSNRQSCIS FSLRPAPWDS AKILVHPSGY        60
     PIEAPPMYSI ISKDSPPNVV LLRGWGEGPW VIVGDARLPT LSSKIHLTFY GQPIIMRLNQ       120
     LSGNYALESP AVGQLKWRPD MFTGRDMQLQ DATGRKLAKL RPGKSGEKLL EILVSHDSSF       180
     SEIVLLSGWT ARAMTKSVTE ATGEILSSVV GA                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page