(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE175

PENCW_16.PE175       Location/Qualifiers
FT   CDS             join(398358..398414,398469..398987,399067..399201,
FT                   399283..400032)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947771"
FT                   /orf_name="Pc20g01750"
FT                   /product="Pc20g01750 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85504.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831488"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR0"
FT                   /transl_table=1
FT                   /translation="MPGVPSSRGCDACRKVKKKCDQLKPTCSRCARLKMTCVGGGQQRY
FT                   MFKNQSVKAMQTQSGAESQSQLQQSFPSTGNRAVWIGKPTRVPSTDTSKMAAAFVAAFQ
FT                   VTDIRYAMAYYGPFLRDIPRRLGNSTVLDSAVRALSTAYSLLHAGSYPPKALVLYGQSL
FT                   RALRECLNDPVEARTPNTLCAVYLITICQSWLGKHDDSLTSHSEAIAHLLRAAALHEWK
FT                   STFEMELVITLCVPIILEGIINPRIKMDSEFWQLASSFRRRLSASRDNNQPQSATELQH
FT                   LAMFPKFVQNPESHLAEIAKTYMQLRLDAQRVKQHLDQCAETVLVSFSSSEVARHCRIQ
FT                   AAYAMLSTLAVLLNSLLRVFDPWNASLVSEAVFLCDEIATQAELASCYRPVGAGYIPLC
FT                   LVVAWAASDNLVQLARIEAILSEYQSDFAEVPWMSRAIWLASTLDSHRIRVMSGKQSPE
FT                   SSLEADSGDSHGAGTKKASVRPESCCIL"
     MPGVPSSRGC DACRKVKKKC DQLKPTCSRC ARLKMTCVGG GQQRYMFKNQ SVKAMQTQSG        60
     AESQSQLQQS FPSTGNRAVW IGKPTRVPST DTSKMAAAFV AAFQVTDIRY AMAYYGPFLR       120
     DIPRRLGNST VLDSAVRALS TAYSLLHAGS YPPKALVLYG QSLRALRECL NDPVEARTPN       180
     TLCAVYLITI CQSWLGKHDD SLTSHSEAIA HLLRAAALHE WKSTFEMELV ITLCVPIILE       240
     GIINPRIKMD SEFWQLASSF RRRLSASRDN NQPQSATELQ HLAMFPKFVQ NPESHLAEIA       300
     KTYMQLRLDA QRVKQHLDQC AETVLVSFSS SEVARHCRIQ AAYAMLSTLA VLLNSLLRVF       360
     DPWNASLVSE AVFLCDEIAT QAELASCYRP VGAGYIPLCL VVAWAASDNL VQLARIEAIL       420
     SEYQSDFAEV PWMSRAIWLA STLDSHRIRV MSGKQSPESS LEADSGDSHG AGTKKASVRP       480
     ESCCIL                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page