(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE176

PENCW_16.PE176       Location/Qualifiers
FT   CDS             join(complement(402758..402821),complement(402519..402691),
FT                   complement(402077..402456),complement(401601..402027),
FT                   complement(400892..401551))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000239129" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947772"
FT                   /orf_name="Pc20g01760"
FT                   /product="Pc20g01760 protein"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85505.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831489"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR1"
FT                   /transl_table=1
FT                   /translation="MWFLPSCFKHPSHFSTDGPTKGCSSMRDFEDQAYTNRDDIPLKET
FT                   GESDDDEEKQVYPPSSKLAPILIGLCFQSFCIALDNTILSTAVPKITEEFNSLSDISWY
FT                   ASAYLLTTCAVTLPFGKIYTYYSTKWTYMIALGLFELGSLICAVTPTSKGLIFGRAIAG
FT                   VGSGGLSPGALLILANSVPLHRRALYFGIIGSTSGIATITGPLLGGLLTDHATWRWCFW
FT                   INLPFGVLTGLVILLFFKDSTSPKPKISRLGQLKRMDPLGILAFIPAIVSLLLCLQWGG
FT                   TKYSWNNARIIALFVLFGVFGFAWCLIQVWKQDDATVPPRLLKDRNVLGAVIHATFLGG
FT                   SFFVFGYYLPIWFQAVKEDSASESGINNLPMVVAMIVFSALGGLMVNIVGYYTPLMFVG
FT                   SAFLTIGSGLCTTFKVDSGRPQWIGYQVILGIGAGLGFQQCINALQTVLPLHDIPVGIA
FT                   IITFAQSLSGAMFISIAQTVFQNRLVASITTYAPNISPNALTKAGAANLSHLVPKNMLP
FT                   SVLHAYNIAVVQTFYVSVAAALLSFIGAGLVQWKSMKRRQKYDGASRSSQ"
     MWFLPSCFKH PSHFSTDGPT KGCSSMRDFE DQAYTNRDDI PLKETGESDD DEEKQVYPPS        60
     SKLAPILIGL CFQSFCIALD NTILSTAVPK ITEEFNSLSD ISWYASAYLL TTCAVTLPFG       120
     KIYTYYSTKW TYMIALGLFE LGSLICAVTP TSKGLIFGRA IAGVGSGGLS PGALLILANS       180
     VPLHRRALYF GIIGSTSGIA TITGPLLGGL LTDHATWRWC FWINLPFGVL TGLVILLFFK       240
     DSTSPKPKIS RLGQLKRMDP LGILAFIPAI VSLLLCLQWG GTKYSWNNAR IIALFVLFGV       300
     FGFAWCLIQV WKQDDATVPP RLLKDRNVLG AVIHATFLGG SFFVFGYYLP IWFQAVKEDS       360
     ASESGINNLP MVVAMIVFSA LGGLMVNIVG YYTPLMFVGS AFLTIGSGLC TTFKVDSGRP       420
     QWIGYQVILG IGAGLGFQQC INALQTVLPL HDIPVGIAII TFAQSLSGAM FISIAQTVFQ       480
     NRLVASITTY APNISPNALT KAGAANLSHL VPKNMLPSVL HAYNIAVVQT FYVSVAAALL       540
     SFIGAGLVQW KSMKRRQKYD GASRSSQ                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page