(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE177

PENCW_16.PE177       Location/Qualifiers
FT   CDS             join(403481..403584,403671..403734,403964..404036,
FT                   404134..404312)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977588"
FT                   /orf_name="Pc20g01770"
FT                   /product="Putative uncharacterized protein Pc20g01770 "
FT                   /protein_id="CAP85506.1"
FT                   /db_xref="UniParc:UPI000183148A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR2"
FT                   /transl_table=1
FT                   /translation="MATGPPHNYPCQSTLVYLGSRTGGLISSSRLERYWDREKGASEQH
FT                   PADLLGILIHHAFICDDKDRRRSNELYDGGSRSVCVSWLIVAEDCRLEGINLHRDLTVY
FT                   HEEPQAVGDLRLGARYFVGGYLAMIEQLGNEFWGS"
     MATGPPHNYP CQSTLVYLGS RTGGLISSSR LERYWDREKG ASEQHPADLL GILIHHAFIC        60
     DDKDRRRSNE LYDGGSRSVC VSWLIVAEDC RLEGINLHRD LTVYHEEPQA VGDLRLGARY       120
     FVGGYLAMIE QLGNEFWGS                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page