(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE179

PENCW_16.PE179       Location/Qualifiers
FT   CDS             join(complement(409960..409984),complement(409858..409909),
FT                   complement(409732..409807),complement(408965..409678),
FT                   complement(408598..408888),complement(408172..408549))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202869" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824362"
FT                   /orf_name="Pc20g01790"
FT                   /product="Pc20g01790 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85508.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183148C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE12"
FT                   /transl_table=1
FT                   /translation="MYTITNIYVLAAFGTIGGALFGFDVSSMSAWIGVDTYTDYFDSPD
FT                   SNLQGGITASMSAGSFAGSIAAGWLADILGRRYALMIASLVWIVGAVVQCSAQNVTHLV
FT                   AGRVVSGLAVGVTSSQTCVYLSELAPARIRGRIVGIQQWAIEWGILIMYLIAYGCVVGV
FT                   SGPAAFRICWGVQAVPGLILFIALFFFPESPRWLASQERWEEALDTLAIIHANGDRHDP
FT                   VVQVEFEEVQEAVRVAHESRDVSFMALFGPRVWKRTMCGMSVQMWQQLLGGNVAMYYVV
FT                   YIFEMAGMTGNTTLWSSAIQYVIFLVTTGCMLPFIDRVGRRNLLLIGSVTCMVVHYIIA
FT                   AVMASKGKPVPDVNGNANLTWEIKGSAGMTVIAFSYIFTGIYGLTWAPTAWIYAAEVFP
FT                   LKFRAKGVGLSAATNWIFNFALAYFVAPAFHNIQWKTYIIFGVFCTVMTFHVFFMYPET
FT                   VGRSLEEIDLVFETDVKPWRTHKIGDIFGEEIERRKELGAKTETGGATHEEVV"
     MYTITNIYVL AAFGTIGGAL FGFDVSSMSA WIGVDTYTDY FDSPDSNLQG GITASMSAGS        60
     FAGSIAAGWL ADILGRRYAL MIASLVWIVG AVVQCSAQNV THLVAGRVVS GLAVGVTSSQ       120
     TCVYLSELAP ARIRGRIVGI QQWAIEWGIL IMYLIAYGCV VGVSGPAAFR ICWGVQAVPG       180
     LILFIALFFF PESPRWLASQ ERWEEALDTL AIIHANGDRH DPVVQVEFEE VQEAVRVAHE       240
     SRDVSFMALF GPRVWKRTMC GMSVQMWQQL LGGNVAMYYV VYIFEMAGMT GNTTLWSSAI       300
     QYVIFLVTTG CMLPFIDRVG RRNLLLIGSV TCMVVHYIIA AVMASKGKPV PDVNGNANLT       360
     WEIKGSAGMT VIAFSYIFTG IYGLTWAPTA WIYAAEVFPL KFRAKGVGLS AATNWIFNFA       420
     LAYFVAPAFH NIQWKTYIIF GVFCTVMTFH VFFMYPETVG RSLEEIDLVF ETDVKPWRTH       480
     KIGDIFGEEI ERRKELGAKT ETGGATHEEV V                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page