(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE18

PENCW_16.PE18        Location/Qualifiers
FT   CDS             join(54698..54729,54775..54859,54919..55044,55106..55156,
FT                   55220..57704,57760..57929,57992..58204)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946677"
FT                   /orf_name="Pc20g00180"
FT                   /product="Pc20g00180 protein"
FT                   /function="glycerophosphodiester phosphodiesterase activity"
FT                   /biological_process="glycerol metabolic process "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP85347.1"
FT                   /db_xref="GO:0006071"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000183190A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF29"
FT                   /transl_table=1
FT                   /translation="MYVCPSVSVTGKFGKQIQRRQLDLPEYAASFVNYKALKKLIKQLS
FT                   ATPTIPAQRTAEEIARANADPQGALRANKEVFFFRLEREIEKVNTFYLQKESEFSLRLR
FT                   TLVDKKRVTQSRATSNSKAPSNFAAMFEGFQQFDGDLNKLQQFVEINETAMSKILKKWD
FT                   KTSKSRMKELYLHRAVEVQPCFNREVLRDLADRATTARLELEAWAEGENIQYDASRPLD
FT                   RTATLGSEEDEMDSQILQSASTGNLQTLREWLARLQQLPDARERATRTFLTAINGFSDE
FT                   VLGLLLESKLVDIHAEDDINERNCLHEAAISGRLFVFHAGLQAGVDFARADVYGRIPLH
FT                   YACMHGRVDMVRHLLAAGPHTVDIMDHDNFTPLIHSIVKGQLACAEQVLCSNARVDPEP
FT                   ESPPMKGMDHRPLKGPDHIPLNLACQHGSLPIARMLLERNAKLLPDAEGLYPQHMVARA
FT                   SQSPELLLLLKEHGADLDQKDKLYQWTPLFHAASEGCVPCLRTLLECGVDAQVPDEKGL
FT                   SSMYYAAWEGHLECMLLLWAQPSGKKPTLGPLDILNGVRMQEPGPMGDMSVVTSVSELE
FT                   MADGIPDLELPPPIIPLRRYGHNFLDKKVFVQLLFDQGNVGSIAFDQAGRHPAARMTIS
FT                   SKLSDLIPRTVMLPIQEETRTISFHVDNLDTFAVDFEIFPTFGSKVIAKSVALPDIFRA
FT                   ESSSTGSGCLPLFDPRLRTIGQLRFNFQVIKPYHGDPLEITHFATYWKATSALDSDHNG
FT                   LVTGSSLSGDYVQLFVQLTQDRVAVLYPQFMINHHGVDIPVSHLTYAQFQAIGADCGAN
FT                   HTEILKFLETEATNDMPQTHRLLAASFLSLRDVLQQLPIDLNVNISLLYPSPTEEKKLH
FT                   MTSLADVNSFADVILTDVFDHARVARDKNPEFMRSVVFTSYNPNICSALNWKQPNYPVL
FT                   LCNDLGQIRDLAGNVDSMPHVNSSGRASMSIKESARIAQSNNFMGLICRSSLLNVVPAL
FT                   VETIKELGLVLVADTSDEVSQPDRLEELPTDTMGVAEWAYRMPDGVNGVMRANGILRFN
FT                   DMIDM"
     MYVCPSVSVT GKFGKQIQRR QLDLPEYAAS FVNYKALKKL IKQLSATPTI PAQRTAEEIA        60
     RANADPQGAL RANKEVFFFR LEREIEKVNT FYLQKESEFS LRLRTLVDKK RVTQSRATSN       120
     SKAPSNFAAM FEGFQQFDGD LNKLQQFVEI NETAMSKILK KWDKTSKSRM KELYLHRAVE       180
     VQPCFNREVL RDLADRATTA RLELEAWAEG ENIQYDASRP LDRTATLGSE EDEMDSQILQ       240
     SASTGNLQTL REWLARLQQL PDARERATRT FLTAINGFSD EVLGLLLESK LVDIHAEDDI       300
     NERNCLHEAA ISGRLFVFHA GLQAGVDFAR ADVYGRIPLH YACMHGRVDM VRHLLAAGPH       360
     TVDIMDHDNF TPLIHSIVKG QLACAEQVLC SNARVDPEPE SPPMKGMDHR PLKGPDHIPL       420
     NLACQHGSLP IARMLLERNA KLLPDAEGLY PQHMVARASQ SPELLLLLKE HGADLDQKDK       480
     LYQWTPLFHA ASEGCVPCLR TLLECGVDAQ VPDEKGLSSM YYAAWEGHLE CMLLLWAQPS       540
     GKKPTLGPLD ILNGVRMQEP GPMGDMSVVT SVSELEMADG IPDLELPPPI IPLRRYGHNF       600
     LDKKVFVQLL FDQGNVGSIA FDQAGRHPAA RMTISSKLSD LIPRTVMLPI QEETRTISFH       660
     VDNLDTFAVD FEIFPTFGSK VIAKSVALPD IFRAESSSTG SGCLPLFDPR LRTIGQLRFN       720
     FQVIKPYHGD PLEITHFATY WKATSALDSD HNGLVTGSSL SGDYVQLFVQ LTQDRVAVLY       780
     PQFMINHHGV DIPVSHLTYA QFQAIGADCG ANHTEILKFL ETEATNDMPQ THRLLAASFL       840
     SLRDVLQQLP IDLNVNISLL YPSPTEEKKL HMTSLADVNS FADVILTDVF DHARVARDKN       900
     PEFMRSVVFT SYNPNICSAL NWKQPNYPVL LCNDLGQIRD LAGNVDSMPH VNSSGRASMS       960
     IKESARIAQS NNFMGLICRS SLLNVVPALV ETIKELGLVL VADTSDEVSQ PDRLEELPTD      1020
     TMGVAEWAYR MPDGVNGVMR ANGILRFNDM IDM                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page