(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE184

PENCW_16.PE184       Location/Qualifiers
FT   CDS             join(complement(421396..421734),complement(420974..421326),
FT                   complement(420597..420915))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181609" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824364"
FT                   /orf_name="Pc20g01840"
FT                   /product="Pc20g01840 protein"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="CAP85513.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI0001831491"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE17"
FT                   /transl_table=1
FT                   /translation="MSLFGSVFGFFLRGASPILGMVAVSSFLYLIVDHIHIPRWWDKKT
FT                   HLIGRKSPERITRHECPYDYLREIYGKHHWKAFVHKLSPALHNDDPAKYSMVLEIMDAI
FT                   HLCLMLVDDISDGSDYRKGRPAAHSIYGPSETGNRAYYRVTQILNKTTKDFPNLAPWLM
FT                   QDLQDILEGQDISLIWRRDGLSAFPIATAERLAAYRRMASLKTGSLFRLLGHIVLENDS
FT                   MDETLTTVAWHSQLQNDCKNVYSSEYAKLKGSVAEDLHNREMTYPIVLALDAPDGHLVT
FT                   GALEYPSPRNIRNAMRVIRGDYVRSICTNELRKSGASVKEWLELWGRKEKLDLKA"
     MSLFGSVFGF FLRGASPILG MVAVSSFLYL IVDHIHIPRW WDKKTHLIGR KSPERITRHE        60
     CPYDYLREIY GKHHWKAFVH KLSPALHNDD PAKYSMVLEI MDAIHLCLML VDDISDGSDY       120
     RKGRPAAHSI YGPSETGNRA YYRVTQILNK TTKDFPNLAP WLMQDLQDIL EGQDISLIWR       180
     RDGLSAFPIA TAERLAAYRR MASLKTGSLF RLLGHIVLEN DSMDETLTTV AWHSQLQNDC       240
     KNVYSSEYAK LKGSVAEDLH NREMTYPIVL ALDAPDGHLV TGALEYPSPR NIRNAMRVIR       300
     GDYVRSICTN ELRKSGASVK EWLELWGRKE KLDLKA                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page