(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE186

PENCW_16.PE186       Location/Qualifiers
FT   CDS             join(426313..426540,426597..426751,426801..427127,
FT                   427188..427596)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169461" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947776"
FT                   /orf_name="Pc20g01860"
FT                   /product="Pc20g01860 protein"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="CAP85515.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI0001831493"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE19"
FT                   /transl_table=1
FT                   /translation="MLGLTAAKVFAFISQYIPRITIFTNNKPAASTYYHRRKDLKGFQI
FT                   LQAHTNHTQQNLTLSDGTDSGDCQITEPYEKIVSAPLEYLLCIPGKDIRGKLISAFNEW
FT                   LHLPDDKLAIVKEVIDRLHTASLLIDDIQDASRLRRGHPVAHDVFGVAQTINAANYAYF
FT                   LQQKRLNEINDPRAFHIFTQALLDLHIGQGMDLYWRDALVCPTEAEYTRMVMYKTGGLF
FT                   RLAVELMQIQSTTTTDLSRLVGLLGIIFQIRDDYMNLQSGIYAEKKGLMEDLTEGKFSY
FT                   PVIHSIRADPDNTQLINILKQRSEDRAVKVRAVQYMESTGSFQYCREVLSGLMEQARGH
FT                   VDELETLLGPNQEIHRILDLLQVDPPNVNPRP"
     MLGLTAAKVF AFISQYIPRI TIFTNNKPAA STYYHRRKDL KGFQILQAHT NHTQQNLTLS        60
     DGTDSGDCQI TEPYEKIVSA PLEYLLCIPG KDIRGKLISA FNEWLHLPDD KLAIVKEVID       120
     RLHTASLLID DIQDASRLRR GHPVAHDVFG VAQTINAANY AYFLQQKRLN EINDPRAFHI       180
     FTQALLDLHI GQGMDLYWRD ALVCPTEAEY TRMVMYKTGG LFRLAVELMQ IQSTTTTDLS       240
     RLVGLLGIIF QIRDDYMNLQ SGIYAEKKGL MEDLTEGKFS YPVIHSIRAD PDNTQLINIL       300
     KQRSEDRAVK VRAVQYMEST GSFQYCREVL SGLMEQARGH VDELETLLGP NQEIHRILDL       360
     LQVDPPNVNP RP                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page