(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE187

PENCW_16.PE187       Location/Qualifiers
FT   CDS             complement(428385..428834)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128699"
FT                   /orf_name="Pc20g01870"
FT                   /product="Pc20g01870 protein"
FT                   /protein_id="CAP85516.1"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI0001831494"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE20"
FT                   /transl_table=1
FT                   /translation="MGSGPAKTCFATSSPYEEKIGYYRAVRHGNQIFVSGTTSVDPYSP
FT                   TNAPHVLHPEDARQQTRVALEESIRAIQGLGGKGAEDIVRVKMFVSRHEDCEAVGRGFS
FT                   EILGKHNRGGSGMIGAAATMIVVNGGFINKEMLVEIEVDAVVEYI"
     MGSGPAKTCF ATSSPYEEKI GYYRAVRHGN QIFVSGTTSV DPYSPTNAPH VLHPEDARQQ        60
     TRVALEESIR AIQGLGGKGA EDIVRVKMFV SRHEDCEAVG RGFSEILGKH NRGGSGMIGA       120
     AATMIVVNGG FINKEMLVEI EVDAVVEYI                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page