(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE189

PENCW_16.PE189       Location/Qualifiers
FT   CDS             join(431397..431497,431619..432312)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000100908" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947778"
FT                   /orf_name="Pc20g01890"
FT                   /product="Pc20g01890 protein"
FT                   /function="copper ion binding"
FT                   /biological_process="copper ion homeostasis"
FT                   /protein_id="CAP85518.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0055070"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="UniParc:UPI0001831496"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE22"
FT                   /transl_table=1
FT                   /translation="MSQTAITQIPILEIACFNQESAVVAARAGADRIELCKDYHLGGLS
FT                   ADIEILQELKSQLTTPIYTMVRPHAEGFCYGESDFESMKRTLNSLKSCGADGFVFGILN
FT                   RSPQMSCDPNLPWVDVSRNKQLVQLAGGRPCTFHRAFDLIPESHWENALADIMECGFAS
FT                   ILTNGGPSGTKATESMDKLQTLVRYKTQLQREQKIRGNRVPEIIVGGGVRASNIGLLQS
FT                   ITGASAFHSAALVASKAVTSAKEVSDMKGGIAQAWEADKKAQ"
     MSQTAITQIP ILEIACFNQE SAVVAARAGA DRIELCKDYH LGGLSADIEI LQELKSQLTT        60
     PIYTMVRPHA EGFCYGESDF ESMKRTLNSL KSCGADGFVF GILNRSPQMS CDPNLPWVDV       120
     SRNKQLVQLA GGRPCTFHRA FDLIPESHWE NALADIMECG FASILTNGGP SGTKATESMD       180
     KLQTLVRYKT QLQREQKIRG NRVPEIIVGG GVRASNIGLL QSITGASAFH SAALVASKAV       240
     TSAKEVSDMK GGIAQAWEAD KKAQ                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page