(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE19

PENCW_16.PE19        Location/Qualifiers
FT   CDS             join(complement(58852..59425),complement(58635..58786))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187663" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977329"
FT                   /orf_name="Pc20g00190"
FT                   /product="Pc20g00190 protein"
FT                   /protein_id="CAP85348.1"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniParc:UPI000183190B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF30"
FT                   /transl_table=1
FT                   /translation="MSLRPTLLKQWISRPSEILKSTPSLTSYLHPSARPSLAHRSIIFP
FT                   SAGQATRRSLTTARLPTRTRPGPSSFHPKQRRFNSGSAGGGGKGSGAGAGAGASEKASL
FT                   SQRLKKLSREYGWAALGVYLGLSALDFPFCFAAVRLLGVERIGYYEHVVVGFVKDKLKS
FT                   VWPQTKSSEAEDGQGQLAQAEERNQEEASIWTQLVFAYAIHKSFVFIRVPLTAAVTPKV
FT                   VKTLRGWGWDIGKRKPKST"
     MSLRPTLLKQ WISRPSEILK STPSLTSYLH PSARPSLAHR SIIFPSAGQA TRRSLTTARL        60
     PTRTRPGPSS FHPKQRRFNS GSAGGGGKGS GAGAGAGASE KASLSQRLKK LSREYGWAAL       120
     GVYLGLSALD FPFCFAAVRL LGVERIGYYE HVVVGFVKDK LKSVWPQTKS SEAEDGQGQL       180
     AQAEERNQEE ASIWTQLVFA YAIHKSFVFI RVPLTAAVTP KVVKTLRGWG WDIGKRKPKS       240
     T                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page