(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE190

PENCW_16.PE190       Location/Qualifiers
FT   CDS             join(433686..433794,433902..433972,434066..434302,
FT                   434357..434369,434425..435149,435198..435641)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128700"
FT                   /orf_name="Pc20g01900"
FT                   /product="Pc20g01900 protein"
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85519.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="UniParc:UPI0001831576"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE23"
FT                   /transl_table=1
FT                   /translation="MTLGGKLKFWLKKIQVPSEPGLSTAQLMLTNDDLRPVEPERRQWG
FT                   WLNFVAFWIADSLNVNTWMISSSMIVDGLSWWQSWLCVWIGYTVAAIFVYVLGRIATIY
FT                   RIPFAVANRASFGIWGSFWPIINRAAMAVIWYGVQSYLGGECVTLMIAAIWPSYNNLPN
FT                   TIPSSSGVTTKQFVSFFIFWLLSLPALWFPIYKVRHVFTAKAYFSPACAIAFFGWAIAR
FT                   AHGLGPIIDQPNKAQGSALAWAFVKSIMNCIANFAALVINNPDFTRYARDPKDALWPQL
FT                   ITIPVGFAVTSFIGIIVSSSSSVIFGEAVWNPLTLLGMFLKDASSAERFGIFVIGAGFA
FT                   LAQLGTNIAANSVSAGTNLTALLPRFCTIRRGGYLCAAIGLAMCPWTLVASSSKFTLYL
FT                   SAYSVFLSAIAGVMVSDYYLVRKGFLDIQALYSAERDGIYYGTFGVSWHGYAAYISGIL
FT                   VNIVGFAGAIGVNVPIGAMYIYNVNYFSGFIVSGAVYWALAWLVPIPGTSDTWNEIPYE
FT                   PHHMSDSDEKKVGDV"
     MTLGGKLKFW LKKIQVPSEP GLSTAQLMLT NDDLRPVEPE RRQWGWLNFV AFWIADSLNV        60
     NTWMISSSMI VDGLSWWQSW LCVWIGYTVA AIFVYVLGRI ATIYRIPFAV ANRASFGIWG       120
     SFWPIINRAA MAVIWYGVQS YLGGECVTLM IAAIWPSYNN LPNTIPSSSG VTTKQFVSFF       180
     IFWLLSLPAL WFPIYKVRHV FTAKAYFSPA CAIAFFGWAI ARAHGLGPII DQPNKAQGSA       240
     LAWAFVKSIM NCIANFAALV INNPDFTRYA RDPKDALWPQ LITIPVGFAV TSFIGIIVSS       300
     SSSVIFGEAV WNPLTLLGMF LKDASSAERF GIFVIGAGFA LAQLGTNIAA NSVSAGTNLT       360
     ALLPRFCTIR RGGYLCAAIG LAMCPWTLVA SSSKFTLYLS AYSVFLSAIA GVMVSDYYLV       420
     RKGFLDIQAL YSAERDGIYY GTFGVSWHGY AAYISGILVN IVGFAGAIGV NVPIGAMYIY       480
     NVNYFSGFIV SGAVYWALAW LVPIPGTSDT WNEIPYEPHH MSDSDEKKVG DV               532
//

If you have problems or comments...

PBIL Back to PBIL home page