(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE191

PENCW_16.PE191       Location/Qualifiers
FT   CDS             complement(436899..437900)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947779"
FT                   /orf_name="Pc20g01910"
FT                   /product="Putative uncharacterized protein Pc20g01910 "
FT                   /protein_id="CAP85520.1"
FT                   /db_xref="UniParc:UPI0001831577"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE24"
FT                   /transl_table=1
FT                   /translation="MAESRGGPSNPKFSDLVPLLKGESNWEIWKQYMEIALNGIDPSYW
FT                   PLLIGQDKRPTNLPGMEDSEVDFEDAVTEIDDDTPAHPTAAFATQPTQPTTTKAAIAKR
FT                   KKAQQAWDQKNAIVLSYVASSLDATMLLYFRGGHTAALVYEELRSLYEGKIFFSIRNKV
FT                   TKWATWKYKAGTKPEEFVTEWRHLFTEMQVALPIEQRVSSLYAIYVFLHAVSNNTACQH
FT                   WLNTVSIHDDWSYDEILHNIFGVFIASEGRRIRNDGQLQKQQASANIASADNNKKKKKK
FT                   DNPKGEKEEDKQTKKQYCPFHKRETIHKPKDCFLNPKKKDKSESASMENLWC"
     MAESRGGPSN PKFSDLVPLL KGESNWEIWK QYMEIALNGI DPSYWPLLIG QDKRPTNLPG        60
     MEDSEVDFED AVTEIDDDTP AHPTAAFATQ PTQPTTTKAA IAKRKKAQQA WDQKNAIVLS       120
     YVASSLDATM LLYFRGGHTA ALVYEELRSL YEGKIFFSIR NKVTKWATWK YKAGTKPEEF       180
     VTEWRHLFTE MQVALPIEQR VSSLYAIYVF LHAVSNNTAC QHWLNTVSIH DDWSYDEILH       240
     NIFGVFIASE GRRIRNDGQL QKQQASANIA SADNNKKKKK KDNPKGEKEE DKQTKKQYCP       300
     FHKRETIHKP KDCFLNPKKK DKSESASMEN LWC                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page