(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE192

PENCW_16.PE192       Location/Qualifiers
FT   CDS             join(complement(441158..441277),complement(440924..441106),
FT                   complement(440511..440870),complement(439917..440457),
FT                   complement(439542..439861),complement(439304..439481),
FT                   complement(438866..439215))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159172" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947780"
FT                   /orf_name="Pc20g01920"
FT                   /product="Pc20g01920 protein"
FT                   /biological_process="metabolic process"
FT                   /protein_id="CAP85521.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015936"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="UniParc:UPI0001831578"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE25"
FT                   /transl_table=1
FT                   /translation="MTISEKIFAMHDLNHKGFVAPGDIIRVHVDWILASEVSWAGMETT
FT                   YNHLGKPGIFRNDRFWLCGDHVVDPRVNELPQVQALISGSERAKKTFKMTEYQGMNYTI
FT                   LHTEFYRERAQPGMLVVGSDSHTCSSGAVGCLAIGLGAADVALPLVTGETWFQVPETIN
FT                   IRLVGAPKPGIGGKDVILYILQVLKRNTIASDRIVEFTGPALRHLSPDTRFAVSNMTTE
FT                   LGGITGIFMPDDTTHNFINRRKLARHKCHTTYFRPDADAEYAAVHQIDLTHVGSFIARY
FT                   PNPDDVVPVTEEEGMELNGCFIGACTTTEEDLILGALVMEQAMKRGSKPTAKGKRKVVP
FT                   GSMPILYRLRKLRLCDIYEDAGFEIGIPGCSYCVGMSADQAAPGEVWISSQNRNFENRM
FT                   GKGSIGHLASAATVAASSFEMKLVDPSDLLAAIDLSRWRQLTTASTHSDATSPKSDLIY
FT                   VEPCGCDYHRAGAQTQKQIEKPRLDIHGRGQTKSLQGKVQRLGDFVNTDALAPAEFLIG
FT                   MKNNMDAGLRCLVHTHPKFRERAQQGFNIVVGGKGFGCGSSREQAVMALLGCGVQCVIA
FT                   KSFSFIFQRNMPSLGLLGITMEDESFFQVADDGVSISIDLNSRIIDVAGKTFGFKLSQM
FT                   ETEIFQFGGIASAFGVFGNKLLEAITPAKSPSGYKQEESEQPDKLLQW"
     MTISEKIFAM HDLNHKGFVA PGDIIRVHVD WILASEVSWA GMETTYNHLG KPGIFRNDRF        60
     WLCGDHVVDP RVNELPQVQA LISGSERAKK TFKMTEYQGM NYTILHTEFY RERAQPGMLV       120
     VGSDSHTCSS GAVGCLAIGL GAADVALPLV TGETWFQVPE TINIRLVGAP KPGIGGKDVI       180
     LYILQVLKRN TIASDRIVEF TGPALRHLSP DTRFAVSNMT TELGGITGIF MPDDTTHNFI       240
     NRRKLARHKC HTTYFRPDAD AEYAAVHQID LTHVGSFIAR YPNPDDVVPV TEEEGMELNG       300
     CFIGACTTTE EDLILGALVM EQAMKRGSKP TAKGKRKVVP GSMPILYRLR KLRLCDIYED       360
     AGFEIGIPGC SYCVGMSADQ AAPGEVWISS QNRNFENRMG KGSIGHLASA ATVAASSFEM       420
     KLVDPSDLLA AIDLSRWRQL TTASTHSDAT SPKSDLIYVE PCGCDYHRAG AQTQKQIEKP       480
     RLDIHGRGQT KSLQGKVQRL GDFVNTDALA PAEFLIGMKN NMDAGLRCLV HTHPKFRERA       540
     QQGFNIVVGG KGFGCGSSRE QAVMALLGCG VQCVIAKSFS FIFQRNMPSL GLLGITMEDE       600
     SFFQVADDGV SISIDLNSRI IDVAGKTFGF KLSQMETEIF QFGGIASAFG VFGNKLLEAI       660
     TPAKSPSGYK QEESEQPDKL LQW                                               683
//

If you have problems or comments...

PBIL Back to PBIL home page