(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE193

PENCW_16.PE193       Location/Qualifiers
FT   CDS             join(complement(442139..442151),complement(442017..442061),
FT                   complement(441622..441896))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671676"
FT                   /orf_name="Pc20g01930"
FT                   /product="Putative uncharacterized protein Pc20g01930 "
FT                   /protein_id="CAP85522.1"
FT                   /db_xref="UniParc:UPI0001831579"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE26"
FT                   /transl_table=1
FT                   /translation="MSTPASTYIVIPEASGAQIGHVPSVLRYPLPRGGADRVSSASQQF
FT                   TVQPLYNLPGFIFKTCWPSSLLEQILEKYRPGTMAEGNPSTLNQLVQILAQTRGIHMDV
FT                   PNGKYV"
     MSTPASTYIV IPEASGAQIG HVPSVLRYPL PRGGADRVSS ASQQFTVQPL YNLPGFIFKT        60
     CWPSSLLEQI LEKYRPGTMA EGNPSTLNQL VQILAQTRGI HMDVPNGKYV                  110
//

If you have problems or comments...

PBIL Back to PBIL home page