(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE196

PENCW_16.PE196       Location/Qualifiers
FT   CDS             complement(446073..446936)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000033576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947782"
FT                   /orf_name="Pc20g01960"
FT                   /product="Pc20g01960 protein"
FT                   /function="amino acid binding"
FT                   /function="formyltetrahydrofolate deformylase activity "
FT                   /function="hydroxymethyl-, formyl- and related transferase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="CAP85525.1"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="GO:0008864"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="GO:0016742"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="UniParc:UPI000183157C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE70"
FT                   /transl_table=1
FT                   /translation="MAASFILTLSGPDRPGIVHAVTAFLVQNNLNIIDSSQFGDPTSQR
FT                   FFMRTQFATANGEDETPELEKLRTAFEPTAQSFSLNFEINPSVKKPRVLIMVSKIGHCL
FT                   NDLLFRQSTGQLSIEVPLIVSNHPDFATLAATYNIPFHHLPVTADTKAQQEAQILELVS
FT                   QHNIDLIVLARYMQVLSPTLCSAMSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGAT
FT                   AHFVTSDLDEGPIIEQNVVRVNHGMSPKELTHAGSNVESNVLATAVKYVTERRVILNGH
FT                   KTVVFN"
     MAASFILTLS GPDRPGIVHA VTAFLVQNNL NIIDSSQFGD PTSQRFFMRT QFATANGEDE        60
     TPELEKLRTA FEPTAQSFSL NFEINPSVKK PRVLIMVSKI GHCLNDLLFR QSTGQLSIEV       120
     PLIVSNHPDF ATLAATYNIP FHHLPVTADT KAQQEAQILE LVSQHNIDLI VLARYMQVLS       180
     PTLCSAMSGR IINIHHSFLP SFKGAKPYHQ AYDRGVKIIG ATAHFVTSDL DEGPIIEQNV       240
     VRVNHGMSPK ELTHAGSNVE SNVLATAVKY VTERRVILNG HKTVVFN                     287
//

If you have problems or comments...

PBIL Back to PBIL home page