(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE199

PENCW_16.PE199       Location/Qualifiers
FT   CDS             join(complement(453715..453868),complement(453274..453661),
FT                   complement(452887..453218),complement(452537..452826))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977591"
FT                   /orf_name="Pc20g01990"
FT                   /product="Pc20g01990 protein"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAP85528.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniParc:UPI000183157F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE73"
FT                   /transl_table=1
FT                   /translation="GKYEXLTIPFRLYNTLATFXILINKTLXLFLGRIVVIYLDDILVF
FT                   LDTEDKYYKHLEEVLKCLRKXKLYAKPKKCILITIELEFYSYIISNREVRLLPEKLEAI
FT                   IGXLRLININEVRRFIRLVLYYRRFIYSFSEIAAPLYNLTKEANKELYKKRFRPINXIE
FT                   XCEVTFRRLKEVLISAPILIXLDXAKPFIIETDTLEXAISFVLGXEAKDRKVYLIAFDS
FT                   RKLRAAELNYLVYKKELLVIKEALRIXDRYLENGTTTTIIIDYKGLXYLTTI"
     MPESKIPQPG PAKLKRNAGP DEWLEAAKDC KYLSEPHMKQ LCEIVKEYMM EESNIQPVST        60
     PVTVCGDIHG QFYDLLELFR VSGGMPDGTE LDPPKTSPSV ITSADIEPPS SISDPKIRKK       120
     LRGPTVNSND EEEDSSSRSR SASDTSADLQ LNRNFVFLGD YVDRGYFSLE TLTLLLCLKA       180
     KYPDRVTLVR GNHESRQITQ VYGFYEECFQ KYGSASVWKA CCQVFDFMTL GAIIDGKVLC       240
     VHGGLSPEIR TLDQVRVVAR AQEIPHEGAF CDLVWSDPDD VETWAVSPRG AGWLFGDRVA       300
     DEFCHVNDLS LIARAHQLVN EGYKYHFNNQ NVVTVWSAPN YCYRCGNLAS VCEIGEDLKP       360
     TFKLFSAVSD DQRHVPTSRP GRSEYFL                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page