(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE2

PENCW_16.PE2         Location/Qualifiers
FT   CDS             join(complement(4619..4831),complement(4432..4586),
FT                   complement(4116..4212))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977326"
FT                   /orf_name="Pc20g00020"
FT                   /product="Putative uncharacterized protein Pc20g00020 "
FT                   /protein_id="CAP85331.1"
FT                   /db_xref="UniParc:UPI0001831829"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER1"
FT                   /transl_table=1
FT                   /translation="MGTDDHVRQYNAENSRYFSPHIRLHNPGGSGLAQGMLRVSSGLAQ
FT                   GWLKVGSRLAHGWLTVGSRLAHGWLRGMLRVSSGLAQGMLRVSSGSAQGWLKVGSRLAH
FT                   GWLTVGSRLAHGWLTVGSGSINDHASINKELWHCHRVPAAQKSRSKNGKR"
     MGTDDHVRQY NAENSRYFSP HIRLHNPGGS GLAQGMLRVS SGLAQGWLKV GSRLAHGWLT        60
     VGSRLAHGWL RGMLRVSSGL AQGMLRVSSG SAQGWLKVGS RLAHGWLTVG SRLAHGWLTV       120
     GSGSINDHAS INKELWHCHR VPAAQKSRSK NGKR                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page