(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE20

PENCW_16.PE20        Location/Qualifiers
FT   CDS             join(59860..60643,60718..60824)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000100368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946678"
FT                   /orf_name="Pc20g00200"
FT                   /product="Pc20g00200 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85349.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniParc:UPI000183190C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF31"
FT                   /transl_table=1
FT                   /translation="MSPRLGGLLQLSPVWGAPLITPRIPVRSFGIRSLNPPKPSRFNIG
FT                   PGLPVLESTSTAALRRKANSLPLRTGAIGIKKGMTAIYDPESGKRIPCTVLQLDRVEVI
FT                   SHKTRERHGYYAVQVGAGWKHPSNVTKSMLGHFSVNGISPKRHIFEFRVKDEAGLIPVG
FT                   QSIEAGWFQEGQFVDARSNTKGKGFAGVMKRHGFGGQDRSHGVSLTHRSMGSSGPGQGG
FT                   GSRVYPGKKMAGNMGNTQNTVQNLKILKVDSENGIVVVSGAVSGPKGCVVRIQDAIKKP
FT                   WPEVPQAEATEPATA"
     MSPRLGGLLQ LSPVWGAPLI TPRIPVRSFG IRSLNPPKPS RFNIGPGLPV LESTSTAALR        60
     RKANSLPLRT GAIGIKKGMT AIYDPESGKR IPCTVLQLDR VEVISHKTRE RHGYYAVQVG       120
     AGWKHPSNVT KSMLGHFSVN GISPKRHIFE FRVKDEAGLI PVGQSIEAGW FQEGQFVDAR       180
     SNTKGKGFAG VMKRHGFGGQ DRSHGVSLTH RSMGSSGPGQ GGGSRVYPGK KMAGNMGNTQ       240
     NTVQNLKILK VDSENGIVVV SGAVSGPKGC VVRIQDAIKK PWPEVPQAEA TEPATA           296
//

If you have problems or comments...

PBIL Back to PBIL home page