(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE203

PENCW_16.PE203       Location/Qualifiers
FT   CDS             join(complement(461045..461084),complement(460552..460993),
FT                   complement(460231..460492),complement(460007..460179),
FT                   complement(459645..459954),complement(459153..459593))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216587" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671677"
FT                   /orf_name="Pc20g02030"
FT                   /product="Pc20g02030 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85532.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniParc:UPI0001831583"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE77"
FT                   /transl_table=1
FT                   /translation="MQGFGRNGPRSKSGCSTCRRRKVKCGEEKPVCARCSSLRLNCEWG
FT                   VPVKRGRSTQIRHLEPAPETSEQPSWPTPKAEDLVGFQPDALFASPSPVSWASDALPFD
FT                   TFNPVPIPTPICPSLNVNVACANSLTLTSLDRQYFQYFPSSSLVFYYMKRWKWSSLCHL
FT                   YEGPAASNRIIMRMILALSACDMHRNGLIVRSQDHGRYHYSQAVKEFRQLLETPRQVSL
FT                   DDVGTVFATVFLMIAWEWQFGNSVRHLQLHLQGVRSLLETHPQLFRIKDVNDMFCSPGV
FT                   NTLASDSGTMAKVSFIPEQLLLWILYIDASCRPIGLTDSLNDYVAQTGNPALQPDHLYR
FT                   CARLWGRCFWGEQYPDEEVLDDIENYRALELLHVGFCLRHRTWQVLVESAAGTAESAEA
FT                   LFREILATRETFSDLFITARFAGSVSARRTLNTIYMAVSTFYGQVLLHRRLLCVDSLPL
FT                   GIHQQATAGIIDICQKQFLSDPRLLRRLHWPLLMAAIETNDITHQSWLRQRLWELRDFH
FT                   SEFIWAHDVAEQVLALQDVGQGRYINLADFLLKRFHAR"
     MQGFGRNGPR SKSGCSTCRR RKVKCGEEKP VCARCSSLRL NCEWGVPVKR GRSTQIRHLE        60
     PAPETSEQPS WPTPKAEDLV GFQPDALFAS PSPVSWASDA LPFDTFNPVP IPTPICPSLN       120
     VNVACANSLT LTSLDRQYFQ YFPSSSLVFY YMKRWKWSSL CHLYEGPAAS NRIIMRMILA       180
     LSACDMHRNG LIVRSQDHGR YHYSQAVKEF RQLLETPRQV SLDDVGTVFA TVFLMIAWEW       240
     QFGNSVRHLQ LHLQGVRSLL ETHPQLFRIK DVNDMFCSPG VNTLASDSGT MAKVSFIPEQ       300
     LLLWILYIDA SCRPIGLTDS LNDYVAQTGN PALQPDHLYR CARLWGRCFW GEQYPDEEVL       360
     DDIENYRALE LLHVGFCLRH RTWQVLVESA AGTAESAEAL FREILATRET FSDLFITARF       420
     AGSVSARRTL NTIYMAVSTF YGQVLLHRRL LCVDSLPLGI HQQATAGIID ICQKQFLSDP       480
     RLLRRLHWPL LMAAIETNDI THQSWLRQRL WELRDFHSEF IWAHDVAEQV LALQDVGQGR       540
     YINLADFLLK RFHAR                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page