(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE204

PENCW_16.PE204       Location/Qualifiers
FT   CDS             join(complement(462827..462922),complement(462385..462767),
FT                   complement(462240..462328),complement(461873..462176),
FT                   complement(461685..461812),complement(461387..461622))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000251261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671678"
FT                   /orf_name="Pc20g02040"
FT                   /product="Pc20g02040 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP85533.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="UniParc:UPI0001831584"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE78"
FT                   /transl_table=1
FT                   /translation="MTLTTINIEEVKTSVDAALEALQQDLRELNHRIWSNPELAYEEHR
FT                   AHDTICDFLEGQGFTVTRHAYGLETSFEVLSGTGGRLVNFNAEYDALPGIGHACGHNLI
FT                   ATSSIAAFLALSFAISKFNIPGRAQLLGTPAEENGGGKAKLIDAGAYKNVDISLMAHPG
FT                   PKKIYPDQEPSDGIAGTPMNARKNIHCEFTGRNAHAGGNPWEGINALDALVSSYNNVAV
FT                   LRQQLLPDQRVHCAFLDTPKVANVIPDYTKAFWQVRSPTLKGLNALVGKLRNCIEAGAL
FT                   ATGCQVKIEENELYTDVRLNDTLCERYQVHMGRYSRNVLKRHDKVLTGSSDIGNVSYET
FT                   PTLHTMFAIPAPATSFPHHPTFAAAAGTDEAHAEALIVGKSLALIGWDMIVENDMYDLA
FT                   RRQWKDEIVREE"
     MTLTTINIEE VKTSVDAALE ALQQDLRELN HRIWSNPELA YEEHRAHDTI CDFLEGQGFT        60
     VTRHAYGLET SFEVLSGTGG RLVNFNAEYD ALPGIGHACG HNLIATSSIA AFLALSFAIS       120
     KFNIPGRAQL LGTPAEENGG GKAKLIDAGA YKNVDISLMA HPGPKKIYPD QEPSDGIAGT       180
     PMNARKNIHC EFTGRNAHAG GNPWEGINAL DALVSSYNNV AVLRQQLLPD QRVHCAFLDT       240
     PKVANVIPDY TKAFWQVRSP TLKGLNALVG KLRNCIEAGA LATGCQVKIE ENELYTDVRL       300
     NDTLCERYQV HMGRYSRNVL KRHDKVLTGS SDIGNVSYET PTLHTMFAIP APATSFPHHP       360
     TFAAAAGTDE AHAEALIVGK SLALIGWDMI VENDMYDLAR RQWKDEIVRE E                411
//

If you have problems or comments...

PBIL Back to PBIL home page