(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE205

PENCW_16.PE205       Location/Qualifiers
FT   CDS             join(464643..465029,465165..466592)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947785"
FT                   /orf_name="Pc20g02050"
FT                   /product="Pc20g02050 protein"
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85534.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000183166D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE79"
FT                   /transl_table=1
FT                   /translation="MDRKSEYHRGDLQALEHVEYPCPVCKDRMYETEQGFTDHLRNDHQ
FT                   IFSCSKCEKIFAAADELLRHKVEAGHTVPPKTKRKAKSRSPVKSCERARQLPKSPMHLS
FT                   TQETTASKGNDTDRRAQETPATPSTEVTIAPHQAVSLRVRMRSTLPTERDFIFNTSIDH
FT                   VDIACQLVDAGFTTLHAYNTSNATQTILRRAKIGYLEEADYTTAYEAEPNASALCFPPR
FT                   RYDTSHPRPVVIPDIPEHAPKQTKLPNGVTVYGDPDTVAKLAQVVNEFDIWARPGRKPG
FT                   LVNIPKERWMRLRLKPGVTLPRTQVYKLAPRAQNLLDTTFDKLHDEGKMSWATTGCHSL
FT                   ARLHCQGYTTPKTIRTAACTKRGEPHQAHTFTGGSAHRKAIVIACEMIETTVSTSVLAF
FT                   ITAIDFLTGEVLINSYVAPTAPVTNWLTPVTGITPEAMEAAIADGKAFLSNDAVRRALD
FT                   KFLDKDTVVIGHAIQHDLRALNLLHGRIVDISVVTAEAVFSNFSSKTTLPRIWELKTLA
FT                   KELRGIDIQPGLAHNPLEDAVATREVLIWCLRGPECLKAWAEKARSSYERVRLQRGENK
FT                   KGTKNVEKKAGGETVPSAKAQGKKRFSK"
     MDRKSEYHRG DLQALEHVEY PCPVCKDRMY ETEQGFTDHL RNDHQIFSCS KCEKIFAAAD        60
     ELLRHKVEAG HTVPPKTKRK AKSRSPVKSC ERARQLPKSP MHLSTQETTA SKGNDTDRRA       120
     QETPATPSTE VTIAPHQAVS LRVRMRSTLP TERDFIFNTS IDHVDIACQL VDAGFTTLHA       180
     YNTSNATQTI LRRAKIGYLE EADYTTAYEA EPNASALCFP PRRYDTSHPR PVVIPDIPEH       240
     APKQTKLPNG VTVYGDPDTV AKLAQVVNEF DIWARPGRKP GLVNIPKERW MRLRLKPGVT       300
     LPRTQVYKLA PRAQNLLDTT FDKLHDEGKM SWATTGCHSL ARLHCQGYTT PKTIRTAACT       360
     KRGEPHQAHT FTGGSAHRKA IVIACEMIET TVSTSVLAFI TAIDFLTGEV LINSYVAPTA       420
     PVTNWLTPVT GITPEAMEAA IADGKAFLSN DAVRRALDKF LDKDTVVIGH AIQHDLRALN       480
     LLHGRIVDIS VVTAEAVFSN FSSKTTLPRI WELKTLAKEL RGIDIQPGLA HNPLEDAVAT       540
     REVLIWCLRG PECLKAWAEK ARSSYERVRL QRGENKKGTK NVEKKAGGET VPSAKAQGKK       600
     RFSK                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page