(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE206

PENCW_16.PE206       Location/Qualifiers
FT   CDS             join(complement(469816..469891),complement(467201..469659))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824367"
FT                   /orf_name="Pc20g02060"
FT                   /product="Pc20g02060 protein"
FT                   /protein_id="CAP85535.1"
FT                   /db_xref="UniParc:UPI000183166E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE80"
FT                   /transl_table=1
FT                   /translation="MGCSSSCGKPQPSQLTSHLALRPVSPESVTQTLTLSSNPRFHQPF
FT                   LEVPRHTPKVFDEAHDSYDPSTLTTFARQRSPTVERPSTSADHQLRPPSASGSQRPLRR
FT                   IPRQTEVRQSLRRESLRAPVPHPNRPQPPRTTPVSVQVQHAPASGIAELRPALSEAATD
FT                   DNGSTIDDPYQLLNTSYWPQRTTRVSTRTASAILFALEEAIRGPLQLSTDWDEVNASMS
FT                   DMVGVAGPAGPVGNSRVQNGGARVPQNPISGTSQPPSGMRTPTDIMRQRRDREARRKAE
FT                   HEAREREQEELERQQLEQEQLAQAEAQAQTQAQAQAQQYAGVAADNTSQPRTRVPRPSR
FT                   GPEGQAPTVPVTSSGYRPAADAAPSTRPSEHQTAPLTATTGPMPNQSRLAQATGQQPQH
FT                   GRSQSAAENGGQPKPSAFSKSAQALPAGQPGAPQALQQPKRVGFPHAFERWETLSSHWE
FT                   GLTGYWMRKLEQNNEDLERDPLSQQLARQITDLSAAGANLFHAVVELQRLRASSERKFQ
FT                   RWFFDTRAEQERSKEVQADLNRQLKEERQGRADAFSAAQEAEKDKVKAEGLLKEMRREL
FT                   QISKEEARRAWEELGRREQEERDRTNSLRNGEPTLVGGVQVVPMVSGLPSRQNTTRPQT
FT                   RDGAYPGGQAATSMGTDAYGKSAGSTGGQYYEDGTPMSPTGSDPFIEPKKVDPPTSKAP
FT                   YPGPLYEHENPTVPYPGPATSEPDARSYVGSSEAGDEEYAHYSQDPHGNTFSYPPGPPS
FT                   EGSEEYDQSLQEGHYMPDGAYTSAASTIPPPAPASAADYTGAGWGPGTGWESVTPRHRH
FT                   PTRLSDVLEEDEPSRTNPSRATSRSQASRSIL"
     MGCSSSCGKP QPSQLTSHLA LRPVSPESVT QTLTLSSNPR FHQPFLEVPR HTPKVFDEAH        60
     DSYDPSTLTT FARQRSPTVE RPSTSADHQL RPPSASGSQR PLRRIPRQTE VRQSLRRESL       120
     RAPVPHPNRP QPPRTTPVSV QVQHAPASGI AELRPALSEA ATDDNGSTID DPYQLLNTSY       180
     WPQRTTRVST RTASAILFAL EEAIRGPLQL STDWDEVNAS MSDMVGVAGP AGPVGNSRVQ       240
     NGGARVPQNP ISGTSQPPSG MRTPTDIMRQ RRDREARRKA EHEAREREQE ELERQQLEQE       300
     QLAQAEAQAQ TQAQAQAQQY AGVAADNTSQ PRTRVPRPSR GPEGQAPTVP VTSSGYRPAA       360
     DAAPSTRPSE HQTAPLTATT GPMPNQSRLA QATGQQPQHG RSQSAAENGG QPKPSAFSKS       420
     AQALPAGQPG APQALQQPKR VGFPHAFERW ETLSSHWEGL TGYWMRKLEQ NNEDLERDPL       480
     SQQLARQITD LSAAGANLFH AVVELQRLRA SSERKFQRWF FDTRAEQERS KEVQADLNRQ       540
     LKEERQGRAD AFSAAQEAEK DKVKAEGLLK EMRRELQISK EEARRAWEEL GRREQEERDR       600
     TNSLRNGEPT LVGGVQVVPM VSGLPSRQNT TRPQTRDGAY PGGQAATSMG TDAYGKSAGS       660
     TGGQYYEDGT PMSPTGSDPF IEPKKVDPPT SKAPYPGPLY EHENPTVPYP GPATSEPDAR       720
     SYVGSSEAGD EEYAHYSQDP HGNTFSYPPG PPSEGSEEYD QSLQEGHYMP DGAYTSAAST       780
     IPPPAPASAA DYTGAGWGPG TGWESVTPRH RHPTRLSDVL EEDEPSRTNP SRATSRSQAS       840
     RSIL                                                                    844
//

If you have problems or comments...

PBIL Back to PBIL home page