(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE207

PENCW_16.PE207       Location/Qualifiers
FT   CDS             join(470882..471043,471178..471343,471473..471534,
FT                   471623..471669,471716..471735,471765..472065,4
FT                   72164..472230)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128702"
FT                   /orf_name="Pc20g02070"
FT                   /product="Putative uncharacterized protein Pc20g02070 "
FT                   /protein_id="CAP85536.1"
FT                   /db_xref="UniParc:UPI000183166F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE81"
FT                   /transl_table=1
FT                   /translation="MAKMLYNIHIHATVAPFPRNDIASRMFRGPRSKANLESKFRFFKF
FT                   NKNLRSNKKAVAEALEETRTTAAIPGFEVREATIQSREEIRGRYGVDLCSSLHIPNLGF
FT                   ISANNMSVQAKVLTEFRRDELKRRARVKPYSRAEGSVLMPKCYVGSNTSTPNSNTSSQE
FT                   ALNTTPHRDRNETPKQTEASTTEYGGRNTTSKVICTPCSKAWTSGAKGQQGPRNRKIRY
FT                   LNRAGEGLPAARTHEQKPAMSPERSGNPVLRVLELGAIGQRKYVLQDNSGDS"
     MAKMLYNIHI HATVAPFPRN DIASRMFRGP RSKANLESKF RFFKFNKNLR SNKKAVAEAL        60
     EETRTTAAIP GFEVREATIQ SREEIRGRYG VDLCSSLHIP NLGFISANNM SVQAKVLTEF       120
     RRDELKRRAR VKPYSRAEGS VLMPKCYVGS NTSTPNSNTS SQEALNTTPH RDRNETPKQT       180
     EASTTEYGGR NTTSKVICTP CSKAWTSGAK GQQGPRNRKI RYLNRAGEGL PAARTHEQKP       240
     AMSPERSGNP VLRVLELGAI GQRKYVLQDN SGDS                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page