(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE208

PENCW_16.PE208       Location/Qualifiers
FT   CDS             474298..475998
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194782" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947786"
FT                   /orf_name="Pc20g02080"
FT                   /product="Pc20g02080 protein"
FT                   /protein_id="CAP85537.1"
FT                   /db_xref="UniParc:UPI0001831670"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE82"
FT                   /transl_table=1
FT                   /translation="MDQRGLYCPGELDVLHQDRNRSETTICLPSPSPAKRASSYYPAGP
FT                   KVLEESNLDPFYLEESLAATPSWNPYTSDMRNDSFEDEDQYYTLSLTHKDIHHPSQYGP
FT                   DRSTLAQVELENSLRFHRYTSSTEEHSPLHSSQVSFSSVHTDSTTPDLTPSSSFSSSYD
FT                   SPSCPDAVLEATQQLYKHANQVQIEPRRRFYLPASTPPTYSLPPPPPPPVAPLNPADTR
FT                   PTTPCFQHSNDSTTTITMGYEDTTASCSSRSRRRKQPPSGLTLSRTASSPSTSRRKQSS
FT                   PGTRPPLDPSMISPPSLINPVTMEPHMTHFDHPLFIPANDCPSPVPSPVASSAPISRQW
FT                   TATSMERPSISTIDAFCEQSVWESDSDSESAGRKSMSRRPIDTLRKVRSRAKLRAAKSQ
FT                   PKLHQAMLDGQTCEQFPCMPEDILGEPIPEAFRPSMDRPSTSKEAVRAHSGLQTLRLVA
FT                   PSSASLTRSRSRKNSSLNSSDVDRSAAAAFQAQFRRRQRSDSPEYSNSSSDKGDKEKLT
FT                   SFCYDQYSHTPTNGAREQRPLFERFMNSLRSLNCQKPQKSHKKTNVTTI"
     MDQRGLYCPG ELDVLHQDRN RSETTICLPS PSPAKRASSY YPAGPKVLEE SNLDPFYLEE        60
     SLAATPSWNP YTSDMRNDSF EDEDQYYTLS LTHKDIHHPS QYGPDRSTLA QVELENSLRF       120
     HRYTSSTEEH SPLHSSQVSF SSVHTDSTTP DLTPSSSFSS SYDSPSCPDA VLEATQQLYK       180
     HANQVQIEPR RRFYLPASTP PTYSLPPPPP PPVAPLNPAD TRPTTPCFQH SNDSTTTITM       240
     GYEDTTASCS SRSRRRKQPP SGLTLSRTAS SPSTSRRKQS SPGTRPPLDP SMISPPSLIN       300
     PVTMEPHMTH FDHPLFIPAN DCPSPVPSPV ASSAPISRQW TATSMERPSI STIDAFCEQS       360
     VWESDSDSES AGRKSMSRRP IDTLRKVRSR AKLRAAKSQP KLHQAMLDGQ TCEQFPCMPE       420
     DILGEPIPEA FRPSMDRPST SKEAVRAHSG LQTLRLVAPS SASLTRSRSR KNSSLNSSDV       480
     DRSAAAAFQA QFRRRQRSDS PEYSNSSSDK GDKEKLTSFC YDQYSHTPTN GAREQRPLFE       540
     RFMNSLRSLN CQKPQKSHKK TNVTTI                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page