(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE209

PENCW_16.PE209       Location/Qualifiers
FT   CDS             complement(478705..479391)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048414" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947787"
FT                   /orf_name="Pc20g02090"
FT                   /product="Pc20g02090 protein"
FT                   /protein_id="CAP85538.1"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="UniParc:UPI0001831671"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE83"
FT                   /transl_table=1
FT                   /translation="MSTQDNPAVDNDNSLDDIFGSSPPQNTLNAPLPPTTATSQSTEPS
FT                   DLPGLRRQHVTAGYRDGTSASKGAHVQEGFDGGFPVGAQLGMRAGTVLGIMEGLLRGFE
FT                   ERNGPGVVKKPVRGQSAVSTGTDGATEIAELRRQKREQLRVLYEAALKELDVQAVFAEA
FT                   GGAPEIAPRAEDGEEERAEVQLGRKGDVVIAKWEGRVGVPGWEENMEALEMKEEGKGGG
FT                   QAVEHS"
     MSTQDNPAVD NDNSLDDIFG SSPPQNTLNA PLPPTTATSQ STEPSDLPGL RRQHVTAGYR        60
     DGTSASKGAH VQEGFDGGFP VGAQLGMRAG TVLGIMEGLL RGFEERNGPG VVKKPVRGQS       120
     AVSTGTDGAT EIAELRRQKR EQLRVLYEAA LKELDVQAVF AEAGGAPEIA PRAEDGEEER       180
     AEVQLGRKGD VVIAKWEGRV GVPGWEENME ALEMKEEGKG GGQAVEHS                    228
//

If you have problems or comments...

PBIL Back to PBIL home page