(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE21

PENCW_16.PE21        Location/Qualifiers
FT   CDS             join(complement(61234..61695),complement(61071..61160))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671389"
FT                   /orf_name="Pc20g00210"
FT                   /product="Pc20g00210 protein"
FT                   /protein_id="CAP85350.1"
FT                   /db_xref="InterPro:IPR014807"
FT                   /db_xref="UniParc:UPI000183190D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF32"
FT                   /transl_table=1
FT                   /translation="MVFSRAFTRRAALARQSARPNIASRRTMIAAPGPNTGPLLERRAD
FT                   RELPNPNPGRKWLYTLPIFIIATGAGMLGIFNYQKSSSSIVNSTLYALRTSPRAREILG
FT                   DEIYFAQQIPWISGEMNQLHGRIDISFWVKGTKSQGKMKFRSIRPDRMSYFRTEEWSLE
FT                   TEDGTVVQLLDNDSDPFRKN"
     MVFSRAFTRR AALARQSARP NIASRRTMIA APGPNTGPLL ERRADRELPN PNPGRKWLYT        60
     LPIFIIATGA GMLGIFNYQK SSSSIVNSTL YALRTSPRAR EILGDEIYFA QQIPWISGEM       120
     NQLHGRIDIS FWVKGTKSQG KMKFRSIRPD RMSYFRTEEW SLETEDGTVV QLLDNDSDPF       180
     RKN                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page