(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE210

PENCW_16.PE210       Location/Qualifiers
FT   CDS             join(480371..481107,481142..481337)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217203" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947788"
FT                   /orf_name="Pc20g02100"
FT                   /product="Pc20g02100 protein"
FT                   /protein_id="CAP85539.1"
FT                   /db_xref="UniParc:UPI0001831672"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE84"
FT                   /transl_table=1
FT                   /translation="MSRLSLRLLGFTTAATGLAGYSIHRGLCHLEEKYPALPPAAGSEA
FT                   LRKAHSPNTQHCAYTDIYAAQIPLQVIEARVPNAKTPTQTELEYAWARSVTGSKILRVE
FT                   GSLLGLLTNFRFTPCDTGNSAEGFSPDKTTGAPRILLNGLLQVQRLPATDADSNGLLVS
FT                   MELPDAPRLFFEKIARWGYPWRLMSGVRHEMSVSEPFQRNGGIFVEVRFASAHDYEVVY
FT                   AEGELEKQKIIPAWVLRLHRGYASGKLRNNAANAGYMGYLHIPDLKLPGPSVCGGISQV
FT                   MEALAYSTLTLPSRYQAYIYLTILSIESN"
     MSRLSLRLLG FTTAATGLAG YSIHRGLCHL EEKYPALPPA AGSEALRKAH SPNTQHCAYT        60
     DIYAAQIPLQ VIEARVPNAK TPTQTELEYA WARSVTGSKI LRVEGSLLGL LTNFRFTPCD       120
     TGNSAEGFSP DKTTGAPRIL LNGLLQVQRL PATDADSNGL LVSMELPDAP RLFFEKIARW       180
     GYPWRLMSGV RHEMSVSEPF QRNGGIFVEV RFASAHDYEV VYAEGELEKQ KIIPAWVLRL       240
     HRGYASGKLR NNAANAGYMG YLHIPDLKLP GPSVCGGISQ VMEALAYSTL TLPSRYQAYI       300
     YLTILSIESN                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page