(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE211

PENCW_16.PE211       Location/Qualifiers
FT   CDS             join(complement(481899..482000),complement(481481..481846))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194771" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824368"
FT                   /orf_name="Pc20g02110"
FT                   /product="Putative uncharacterized protein Pc20g02110 "
FT                   /protein_id="CAP85540.1"
FT                   /db_xref="UniParc:UPI0001831673"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA0"
FT                   /transl_table=1
FT                   /translation="MKFLAVCLMAIGLSRWTVNALPSPEDLAVLAYRAWDFRFLSEAPP
FT                   VCNSSVNNIEYSILHYSGAKRRDCQVLNLAKFNSTNVKSISWKSPSETNRYDLCMFSSP
FT                   DCSGGEDSLLGSINNGWDVCYLYNGFESWSIIPNGDACVPDGGDEEEGQGE"
     MKFLAVCLMA IGLSRWTVNA LPSPEDLAVL AYRAWDFRFL SEAPPVCNSS VNNIEYSILH        60
     YSGAKRRDCQ VLNLAKFNST NVKSISWKSP SETNRYDLCM FSSPDCSGGE DSLLGSINNG       120
     WDVCYLYNGF ESWSIIPNGD ACVPDGGDEE EGQGE                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page